Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2173 |
| Peptide Name | Defensin AMP1 / Ct-AMP1 |
| PMID(s) | 7628617 |
| Plant Source (Scientific Name) | Clitoria ternatea |
| Plant Source (Common Name) | Asian pigeonwings |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site: lipid bilayer |
| Activity Against | Botrytis cinerea (IC50: 20 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Cladosporium sphaerospermum (IC50: 6 µg/ml), Cladosporium sphaerospermum (IC50: 100 µg/ml), Fusarium culmorum (IC50: 10 µg/ml), Fusarium culmorum (IC50: 50 µg/ml), Fusarium culmorum (IC50: 0.6 µg/ml), Fusarium culmorum (IC50: 20 µg/ml), Fusarium culmorum (IC50: >40 µg/ml), Fusarium culmorum (IC50: 7 µg/ml), Fusarium culmorum (IC50: >40 µg/ml), Neurospora crassa (IC50: 0.2 µg/ml), Neurospora crassa (IC50: 0.9 µg/ml), Neurospora crassa (IC50: 0.8 µg/ml), Neurospora crassa (IC50: 1.8 µg/ml), Leptosphaeria maculans (IC50: 6 µg/ml), Leptosphaeria maculans (IC50: 20 µg/ml), Penicillium digitatum (IC50: 20 µg/ml), Penicillium digitatum (IC50: 80 µg/ml), Trichoderma viride (IC50: >100 µg/ml), Septoria tritici (IC50: 2 µg/ml), Septoria tritici (IC50: 80 µg/ml), Verticillium alboatrum (IC50: 2 µg/ml), Verticillium albo-atrum (IC50: >100 µg/ml), Bacillus subtilis (IC50: 15 µg/ml), Escherichia coli, Micrococcus luteus, Proteus vulgaris, Staphylococcus aureus, Streptococcus faecalis |
| IC50 value | 20 µg/ml | >100 µg/ml | 6 µg/ml | 100 µg/ml | 10 µg/ml | 50 µg/ml | 0.6 µg/ml | 20 µg/ml | >40 µg/ml | 7 µg/ml | >40 µg/ml | 0.2 µg/ml | 0.9 µg/ml | 0.8 µg/ml | 1.8 µg/ml | 6 µg/ml | 20 µg/ml | 20 µg/ml | 80 µg/ml | >100 µg/ml | 2 µg/ml | 80 µg/ml | 2 µg/ml | >100 µg/ml | 15 µg/ml |
| Sequence | NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFNC |
| Sequence Length | 49 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5613.27 |
| Monoisotopic Molecular Weight (Da) | 5609.36 |
| Isoelectric Point (pI) | 8.51 |
| Method / Extraction | --NA-- |
