Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2168 |
| Peptide Name | Vitri peptide A |
| PMID(s) | 20580652, 14987049, 18191970 |
| Plant Source (Scientific Name) | Viola arvensis, Viola biflora, Viola tricolor |
| Plant Source (Common Name) | European field pansy, alpine yellow-violet, heartsease |
| Plant Family | Violaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Anticancer, Antimicrobial, Cytotoxic |
| Peptide Function Description | Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at 8.91 µM; Vitri A shown to possess cytotoxic activity in cancer cells. |
| Activity Against | Human glioblastoma U251-MG (IC50: 6.03 µg/ml), Human breast adenocarcinoma MDA-MB-231 (IC50: 3.69 µg/ml), Human lung carcinoma A549 (IC50: 3.90 µg/ml), Human prostate cancer DU145 (IC50: 3.07 µg/ml), Human hepatocarcinoma BEL-7402 (IC50: 4.94 µg/ml), Human histiocytic lymphoma U-937/GTB (IC50: 0.6 µM), Human Myeloma cells RPMI-8226/s (IC50: 1 µM) |
| IC50 value | 6.03 µg/ml | 3.69 µg/ml | 3.90 µg/ml | 3.07 µg/ml | 4.94 µg/ml | 0.6 µM | 1 µM |
| Sequence | GIPCGESCVWIPCITSAIGCSCKSKVCYRN |
| Sequence Length | 30 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3178.78 |
| Monoisotopic Molecular Weight (Da) | 3176.44 |
| Isoelectric Point (pI) | 8.33 |
| Method / Extraction | MS |
