Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2154 |
| Peptide Name | ToAMP1 |
| PMID(s) | 22640720 |
| Plant Source (Scientific Name) | Taraxacum officinale |
| Plant Source (Common Name) | Common Dandelion |
| Plant Family | Asteraceae |
| Peptide Family | Cysteine rich peptides |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Fusarium oxysporum, Fusarium graminearum, Botrytis cinerea (IC50: 5.8 µM), Aspergillus niger (IC50: 5.6 µM), Pythium debaryanum, Bipolaris sorokiniana |
| IC50 value | 5.8 µM | 5.6 µM |
| Sequence | VAKCTEESGGKYFVFCCYKPTRICYMNEQKCESTCIGK |
| Sequence Length | 38 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 4349.08 |
| Monoisotopic Molecular Weight (Da) | 4345.95 |
| Isoelectric Point (pI) | 8.29 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | B3EWQ1 |
| NCBI | 408387560 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_5116, EROP-Moscow_12040, CAMPSQ4129, APD_01979 |
| Addtional Information | Synthesis Type: Ribosomal; Not active up to 10 µM- Fusarium oxysporum, Fusarium graminearum, Pythium debaryanum, Bipolaris sorokiniana; Also active against P. syringae, B. subtilis, X. campestris (inhibition is given in cm) |