Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2142 |
| Peptide Name | Antimicrobial Seed Protein/AC34H |
| PMID(s) | 27208129, 10759497 |
| Plant Source (Scientific Name) | Psychotria leptothyrsa |
| Plant Source (Common Name) | wild coffee |
| Plant Family | Rubiaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer; These are identified as good candidates for development of natural additives to prevent food spoilage. |
| Activity Against | Lactobacillus brevis, Pediococcus dextrinicus, Staphylococcus aureus Newman, Bacillus cereus, Salmonella typhimurium, Escherichia coli, Pseudomonas aeruginosa |
| IC50 value | --NA-- |
| Sequence | ACIKNGGRCVASGGPPYCCSNYCLQIAGQSYGVCKKH |
| Sequence Length | 37 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 3837.46 |
| Monoisotopic Molecular Weight (Da) | 3834.73 |
| Isoelectric Point (pI) | 8.89 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q9SDS1 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_9719, EROP-Moscow_09079, APD_00917 |
| Addtional Information | Synthesis Type: Ribosomal; 95% Inhibition against Lactobacillus brevis at >45 ¼g/ml; 95% Inhibition against Pediococcus dextrinicus at >45 ¼g/ml; 95% Inhibition against Staphylococcus aureus Newman at >45 ¼g/ml; 95% Inhibition against Bacillus cereus at >45 ¼g/ml; 95% Inhibition against at Salmonella typhimurium >45 ¼g/ml; 95% Inhibition against at Escherichia coli >45 ¼g/ml; 95% Inhibition against Pseudomonas aeruginosa at >45 ¼g/ml; It contains 3 S-S bonds. |