Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2136 |
| Peptide Name | VaD1, Va defensin 1 |
| PMID(s) | 15713009 |
| Plant Source (Scientific Name) | Vigna angularis |
| Plant Source (Common Name) | azuki bean |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Fusarium oxysporum(IC50: 30 µg/ml), Fusarium oxysporum f. sp. pisi(IC50: 53.2 µg/ml), Trichophyton rubrum(IC50: >500 µg/ml), Staphylococcus epidermidis(IC50: 36.6 µg/ml), Xanthomonas campestris pv. vesicatoria(IC50: 40.8 µg/ml), Salmonella typhimurium(IC50: 143.4 µg/ml), Bacillus cereus(IC50: >500 µg/ml), Escherichia coli(IC50: >500 µg/ml), Erwinia carotovora subsp. carotovora(IC50: 1000 µg/ml), Proteus vulgaris(IC50: >1000 µg/ml), Salmonella enteritidis(IC50: >1000 µg/ml), Pseudomonas syringae pv. syringae(IC50: >1000 µg/ml) |
| IC50 value | 30 µg/ml | 53.2 µg/ml | >500 µg/ml | 36.6 µg/ml | 40.8 µg/ml | 143.4 µg/ml | >500 µg/ml | >500 µg/ml | 1000 µg/ml | >1000 µg/ml | >1000 µg/ml | >1000 µg/ml |
| Sequence | KTCMTKKEGWGRCLIDTTCAHSCRKQGYKGGNCKGMRRTCYCLLDC |
| Sequence Length | 46 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5209.17 |
| Monoisotopic Molecular Weight (Da) | 5205.37 |
| Isoelectric Point (pI) | 9.2 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_5877, EROP-Moscow_09180 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; Has insecticidal activity |
