Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2132 |
| Peptide Name | Cliotide T13 |
| PMID(s) | 27007913 |
| Plant Source (Scientific Name) | Clitoria ternatea |
| Plant Source (Common Name) | Asian pigeonwings |
| Plant Family | Fabaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial |
| Peptide Function Description | Target site- Lipid Bilayer, Shown to possess anti-bacterial activity. |
| Activity Against | Escherichia coli (MIC: >100 µM), Staphylococcus aureus, Caenorhabditis elegans |
| IC50 value | --NA-- |
| Sequence | DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN |
| Sequence Length | 31 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 3324.79 |
| Monoisotopic Molecular Weight (Da) | 3322.39 |
| Isoelectric Point (pI) | 4.37 |
| Method / Extraction | NGS, MS |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | A0A0S1RG98 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_9050, Cybase_966 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; Not active up to 100 µM- Staphylococcus aureus/ Cationic cliotides display potent antibacterial activity against Gram-negative bacteria. It also possess prominent immunostimulating activity. Cationic cliotides are capable of secretion of various cytokines and chemokines in human monocytes at both resting and lipopolysaccharide-stimulated states. Hence also used as potential candidates for novel immunomodulating therapeutics., Highly expressed in C. ternatea seed & pod. (Gilding et al., 2016) |
