Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2106 |
| Peptide Name | MCoTI-I, Two inhibitor peptide topologies 1 (21-54) |
| PMID(s) | 28669767, 16336125 |
| Plant Source (Scientific Name) | Momordica cochinchinensis |
| Plant Source (Common Name) | spiny bitter Cucumber |
| Plant Family | Cucurbitaceae |
| Peptide Family | Protease inhibitor I7 |
| Peptide Function | Antibacterial, Anticancer, Antifungal, Protease-inhibitor |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Escherichia coli (MBC50: >160 µM), Escherichia coli (MBC99: >160 µM), Escherichia coli (MIC: >160 µM), Pseudomonas aeruginosa (MBC50: >160 µM), Pseudomonas aeruginosa (MBC99: >160 µM), Pseudomonas aeruginosa (MIC: >160 µM), Staphylococcus aureus (MBC50: >160 µM), Staphylococcus aureus (MBC99: >160 µM), Staphylococcus aureus (MIC: >160 µM), Candida albicans (MFC50: >160 µM), Candida albicans (MFC99: >160 µM), Candida albicans (MIC: >160 µM), Human histiocytic lymphoma U-937/GTB(IC50: >>32 µM) |
| IC50 value | >>32 µM |
| Sequence | GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD |
| Sequence Length | 34 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3504.97 |
| Monoisotopic Molecular Weight (Da) | 3502.52 |
| Isoelectric Point (pI) | 8.34 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | J3R2I9, P82408, J3RCD6 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_10535, Cybase_137 |
| Addtional Information | Synthesis Type: Ribosomal |