Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2096 |
| Peptide Name | Cyclotide cter-P, Cyclotide cliotide T4 |
| PMID(s) | 21596752, 23419988 |
| Plant Source (Scientific Name) | Clitoria ternatea |
| Plant Source (Common Name) | Asian pigeonwings |
| Plant Family | Fabaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Anticancer, Insecticidal, Hemolytic, Anthelmintic, Antibacterial, Cytotoxic |
| Peptide Function Description | Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at 8.4 µM; Shown to possess various antimicrobial and cytotoxic activities. |
| Activity Against | Staphylococcus aureus (MIC: >100 µM), Enterococcus faecalis (MIC: >100 µM), Escherichia coli (MIC: 1.0 µM), Pseudomonas aeruginosa (MIC: 5.5 µM), Klebsiella pneumoniae (MIC: 7.5 µM), Human cervical carcinoma HeLa (IC50: 0.6 µM), Human lung carcinoma A549 (IC50: 0.21 µM), Human lung carcinoma A549/paclitaxel (IC50: 0.45 µM) |
| IC50 value | 0.6 µM | 0.21 µM | 0.45 µM |
| Sequence | GIPCGESCVFIPCITAAIGCSCKSKVCYRN |
| Sequence Length | 30 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3123.74 |
| Monoisotopic Molecular Weight (Da) | 3121.43 |
| Isoelectric Point (pI) | 8.33 |
| Method / Extraction | NGS, MS, PcR |