Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2085 |
| Peptide Name | Cy-AMP3 |
| PMID(s) | 18778743 |
| Plant Source (Scientific Name) | Cycas revoluta |
| Plant Source (Common Name) | Sago palm |
| Plant Family | Cycadaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Clavibacter michiganensis subsp. michiganensis (IC50: 235 µg/ml), Curtobacterium flaccumfaciens pv. oortii (IC50: 195 µg/ml), Agrobacterium radiobacter (IC50: 260 µg/ml), Agrobacterium rhizogenes (IC50: 235 µg/ml), Erwinia carotovora subsp. carotovora (IC50: 230 µg/ml), Fusarium oxysporum(IC50: 250 µg/ml), Geotrichum candidum(IC50: 250 µg/ml) |
| IC50 value | 235 µg/ml | 195 µg/ml | 260 µg/ml | 235 µg/ml | 230 µg/ml | 250 µg/ml | 250 µg/ml |
| Sequence | AVTCNTVVSSLAPCVPFFAGSAAQPTAACCNGVRSLNSAARTTPDRRTACNCIKSSASSIGLNYNKAAKLPSRCTVNVTVPISPSVNCAT |
| Sequence Length | 90 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 9107.43 |
| Monoisotopic Molecular Weight (Da) | 9101.47 |
| Isoelectric Point (pI) | 9.3 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_5259, CAMPSQ3129, APD_01245 |
| Addtional Information | Synthesis Type: Ribosomal/ Weakly active. |