Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2077 |
| Peptide Name | Defensin AFP1 / Hs-AFP1 |
| PMID(s) | 7628617, 24092498, PPepDB_2077_ref1 |
| Plant Source (Scientific Name) | Heuchera sanguinea |
| Plant Source (Common Name) | coral bells |
| Plant Family | Saxifragaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial, Antifungal, Antibiofilm |
| Peptide Function Description | Heuchera sanguinea antifungal protein 1. Defensin AFP1. Cysteine-rich antifungal protein 1. Defensin-like protein 1, Target site: lipid bilayer , a plant defensin exhibiting inhibitory activity against fungal biofilms |
| Activity Against | Botrytis cinerea (IC50: 6 µg/ml), Botrytis cinerea (IC50: 25 µg/ml), Cladosporium sphaerospermum (IC50: 1 µg/ml), Cladosporium sphaerospermum (IC50: 3 µg/ml), Fusarium culmorum (IC50: 1 µg/ml), Fusarium culmorum (IC50: 3 µg/ml), Fusarium culmorum (IC50: 0.9 µg/ml), Fusarium culmorum (IC50: 1.5 µg/ml), Fusarium culmorum (IC50: 20 µg/ml), Fusarium culmorum (IC50: 1 µg/ml), Fusarium culmorum (IC50: 2.5 µg/ml), Neurospora crassa (IC50: 0.8 µg/ml), Neurospora crassa (IC50: 0.3 µg/ml), Neurospora crassa (IC50: 0.6 µg/ml), Leptosphaeria maculans (IC50: 25 µg/ml), Leptosphaeria maculans (IC50: >100 µg/ml), Penicillium digitatum (IC50: 1 µg/ml), Penicillium digitatum (IC50: 3 µg/ml), Trichoderma viride (IC50: 15 µg/ml), Trichoderma viride (IC50: >100 µg/ml), Septoria tritici (IC50: 0.5 µg/ml), Septoria tritici (IC50: 3 µg/ml), Verticillium albo-atrum (IC50: 12 µg/ml), Verticillium albo-atrum (IC50: 30 µg/ml), Bacillus subtilis, Escherichia coli, Micrococcus luteus, Proteus vulgaris, Staphylococcus aureus, Streptococcus faecalis |
| IC50 value | 6 µg/ml | 25 µg/ml | 1 µg/ml | 3 µg/ml | 1 µg/ml | 3 µg/ml | 0.9 µg/ml | 1.5 µg/ml | 20 µg/ml | 1 µg/ml | 2.5 µg/ml | 0.8 µg/ml | 0.3 µg/ml | 0.6 µg/ml | 25 µg/ml | >100 µg/ml | 1 µg/ml | 3 µg/ml | 15 µg/ml | >100 µg/ml | 0.5 µg/ml | 3 µg/ml | 12 µg/ml | 30 µg/ml |
| Sequence | DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC |
| Sequence Length | 54 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5948.71 |
| Monoisotopic Molecular Weight (Da) | 5944.58 |
| Isoelectric Point (pI) | 8.49 |
| Method / Extraction | --NA-- |
