Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2076 |
| Peptide Name | Sm AMP3 |
| PMID(s) | 26196691 |
| Plant Source (Scientific Name) | Stellaria media |
| Plant Source (Common Name) | Chickweed |
| Plant Family | Caryophyllaceae |
| Peptide Family | Hevein, Chitin-binding |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer; It exhibits potent antifungal activity against important plant pathogens in the micromolar range. It is also represent an important player In the plant immune system. |
| Activity Against | Aspergillus niger (IC50: 5.4 µM), Bipolaris sorokiniana (IC50: 2.0 µM), Botrytis cinerea (IC50: 1.6 µM), Fusarium solani (IC50: 3.7 µM), Alternaria alternata (IC50: 5.0 µM), Escherichia coli, Erwinia carotovora, Clavibacter michiganensis pv. michiganensis, Agrobacterium rhizogenes, Bacillus subtilis, Pseudomonas syringae pv. Tomato |
| IC50 value | 5.4 µM | 2.0 µM | 1.6 µM | 3.7 µM | 5.0 µM |
| Sequence | VGPGGECGGRFGGCAGGQCCSRFGFCGSGPKYCAH |
| Sequence Length | 35 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3370.79 |
| Monoisotopic Molecular Weight (Da) | 3368.36 |
| Isoelectric Point (pI) | 8.34 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_8297, APD_02585 |
| Addtional Information | Synthesis Type: Ribosomal; Not active up to 10 µM- Escherichia coli, Erwinia carotovora, Clavibacter michiganensis pv. michiganensis, Agrobacterium rhizogenes, Bacillus subtilis, Pseudomonas syringae pv. Tomato; APD analysis reveals that the sequence of SmAMP3 most resembles (57.1% similarity) plant chitin-binding Ac-AMP1 |