Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2072 |
| Peptide Name | ToAMP4 |
| PMID(s) | 23771034 |
| Plant Source (Scientific Name) | Taraxacum officinale |
| Plant Source (Common Name) | Common Dandelion |
| Plant Family | Asteraceae |
| Peptide Family | --NA-- |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer, Shows broad-spectrum antifungal activity against important phytopathogens. |
| Activity Against | Alternaria alternata(IC50: 2.9 µM), Alternaria alternata(MIC: 1 µM), Aspergillus niger (IC50: 4.2 µM), Aspergillus niger (MIC: 2.8 µM), Bipolaris sorokiniana(IC50: >15 µM), Bipolaris sorokiniana(MIC: >15 µM), Colletotrichum gloeosporioides (IC50: >15 µM), Colletotrichum gloeosporioides (MIC: >15 µM), Fusarium avenAngiotensin Converting Enzymeum (IC50: 13.1 µM), Fusarium avenAngiotensin Converting Enzymeum (MIC: 6.7 µM), Phoma betae (IC50: 10.7 µM), Phoma betae (MIC: 8 µM), Verticillium albo-atrum (IC50: >15 µM), Verticillium albo-atrum (MIC: >15 µM), Pseudomonas syringae, Bacillus subtilis, Escherichia coli, Clavibacter michiganensis subsp. Michiganensis |
| IC50 value | 2.9 µM | 4.2 µM | >15 µM | >15 µM | 13.1 µM | 10.7 µM | >15 µM |
| Sequence | GYGDGCYSEDDLSVCCKKKFKVIGKCFKSVRECQNSGCKYH |
| Sequence Length | 41 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 4614.3 |
| Monoisotopic Molecular Weight (Da) | 4611.09 |
| Isoelectric Point (pI) | 8.6 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_5686, APD_02236 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; Not active up to 100 µM- Pseudomonas syringae VKM B-1546, Bacillus subtilis VKM B-501, Escherichia coli DH5alpha, Clavibacter michiganensis subsp. michiganensis VKM Ac-1144 |
