Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2069 |
| Peptide Name | Parigidin-br1 |
| PMID(s) | 22074926 |
| Plant Source (Scientific Name) | Palicourea rigida |
| Plant Source (Common Name) | --NA-- |
| Plant Family | Rubiaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial, Insecticidal |
| Peptide Function Description | Target site- Lipid Bilayer; 41% Hemolysis & 28% Hemolysis against Human erythrocytes at 40 µM & 20 µM respectively, Shows highly insecticidal activity. |
| Activity Against | Escherichia coli, Staphylococcus aureus, Spodoptera frugiperda ovarian Sf9 cells, Lepidoptera (Diatraea saccharalis) |
| IC50 value | --NA-- |
| Sequence | GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD |
| Sequence Length | 32 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3304.85 |
| Monoisotopic Molecular Weight (Da) | 3302.42 |
| Isoelectric Point (pI) | 6.03 |
| Method / Extraction | MS, Amino acid analysis |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | B3EWF1 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_4343, APD_01915, Cybase_744 |
| Addtional Information | Synthesis Type: Ribosomal; Shows 50% Cytotoxicity against Spodoptera frugiperda at 1.7 µM, This circular peptide showed no antibacterial activity. However, it is insecticidal presumbly by lysis of insect cells. The peptide is also hemolytic (41% at 40 uM). A theoretic model is provided in the paper. |