Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2048 |
| Peptide Name | Defensin-like protein 2A/Sa-AFP2 |
| PMID(s) | 8422949 |
| Plant Source (Scientific Name) | Sinapis alba |
| Plant Source (Common Name) | White mustard |
| Plant Family | Brassicaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site: lipid bilayer |
| Activity Against | Alternaria brassicicola (IC50: 4.5 µg/ml), Alternaria brassicicola (IC50: >100 µg/ml), Botrytis cinerea (IC50: 3.5 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Fusarium culmorum (IC50: 2.3 µg/ml), Fusarium culmorum (IC50: 32 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: 2.3 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: >100 µg/ml), Pyricularia oryzae (IC50: 0.3 µg/ml), Pyricularia oryzae (IC50: 3.8 µg/ml), Verticillium dahliae (IC50: 1.2 µg/ml), Verticillium dahliae (IC50: >100 µg/ml), Agrobacterium tumefaciens, Alcaligenes eutrophus, Azospirillum brasilense, Erwinia carotovora, Pseudomonas solanAngiotensin Converting Enzymearum, Bacillus megaterium, Sarcina lutea |
| IC50 value | 4.5 µg/ml | >100 µg/ml | 3.5 µg/ml | >100 µg/ml | 2.3 µg/ml | 32 µg/ml | 2.3 µg/ml | >100 µg/ml | 0.3 µg/ml | 3.8 µg/ml | 1.2 µg/ml | >100 µg/ml |
| Sequence | XKLCQRPXGTWSGVCGNNNACRNQCINLEKARHGSCNYVFPAHKCICYFPC |
| Sequence Length | 51 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5729.03 |
| Monoisotopic Molecular Weight (Da) | 5725.01 |
| Isoelectric Point (pI) | 8.92 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P30232 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_1950 |
|---|
| Addtional Information | Synthesis Type : Ribosomal |
