Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_2047
Peptide Name	Defensin-like protein / 2 Rs-AFP2
PMID(s)	7628617, 8422949, 1639777
Plant Source (Scientific Name)	Raphanus sativus
Plant Source (Common Name)	Radish
Plant Family	Brassicaceae
Peptide Family	Defensin
Peptide Function	Antibacterial, Antifungal
Peptide Function Description	Target site: lipid bilayer
Activity Against	Botrytis cinerea (IC50: 10 µg/ml), Botrytis cinerea (IC50: 100 µg/ml), Cladosporium sphaerospermum (IC50: 3 µg/ml), Cladosporium sphaerospermum (IC50: 10 µg/ml), Fusarium culmorum (IC50: 1.5 µg/ml), Fusarium culmorum (IC50: 6 µg/ml), Fusarium culmorum (IC50: 5 µg/ml), Fusarium culmorum (IC50: 5.1 µg/ml), Fusarium culmorum (IC50: 11 µg/ml), Fusarium culmorum (IC50: 5 µg/ml), Neurospora crassa (IC50: 5 µg/ml), Leptosphaeria maculans (IC50: 12 µg/ml), Leptosphaeria maculans (IC50: >100 µg/ml), Penicillium digitatum (IC50: 1.5 µg/ml), Penicillium digitatum (IC50: 12 µg/ml), Trichoderma viride (IC50: 30 µg/ml), Trichoderma viride (IC50: >100 µg/ml), Septoria tritici (IC50: 1.5 µg/ml), Septoria tritici (IC50: 6 µg/ml), Verticillium alboatrum (IC50: 12 µg/ml), Verticillium albo-atrum (IC50: >100 µg/ml), Bacillus subtilis, Escherichia coli, Micrococcus luteus, Proteus vulgaris, Staphylococcus aureus, Streptococcus faecalis, Alternaria brassicicola (IC50: 2 µg/ml), Alternaria brassicicola (IC50: 20 µg/ml), Botrytis cinerea (IC50: 2 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Fusarium culmorum (IC50: 2 µg/ml), Fusarium culmorum (IC50: 5 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: 2 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: >100 µg/ml), Pyricularia oryzae (IC50: 0.4 µg/ml), Pyricularia oryzae (IC50: 7 µg/ml), Verticillium dahliae (IC50: 1.5 µg/ml), Verticillium dahliae (IC50: 50 µg/ml), Ascochyta pisi (IC50: 4 µg/ml), Ascochyta pisi (IC50: 50 µg/ml), Cercospora beticola (IC50: 2 µg/ml), Cercospora beticola (IC50: 3 µg/ml), Colletotrichum lindemuthianum (IC50: 3 µg/ml), Colletotrichum lindemuthianum (IC50: >100 µg/ml), Fusarium culmorum (IC50: 2 µg/ml), Fusarium culmorum (IC50: 5 µg/ml), Fusarium oxysporum f. sp. pisi (IC50: 2 µg/ml), Fusarium oxysporum f. sp. pisi (IC50: >100 µg/ml), Mycosphaerella fijiensis var. fijiensis (IC50: 1.5 µg/ml), Mycosphaerella fijiensis var. fijiensis (IC50: 10 µg/ml), Nectria haematococca (IC50: 2 µg/ml), Nectria haematococca (IC50: 30 µg/ml), Phoma betae (IC50: 1 µg/ml), Phoma betae (IC50: 6 µg/ml), Phytophthora infestans (IC50: 25 µg/ml), Phytophthora infestans (IC50: >100 µg/ml), Pyrenophora tritici-repentis (IC50: 1.5 µg/ml), Pyrenophora tritici-repentis (IC50: 7 µg/ml), Rhizoctonia solani (IC50: >100 µg/ml), Sclerotinia sclerotiorum (IC50: >100 µg/ml), Septoria nodorum (IC50: 15 µg/ml), Septoria nodorum (IC50: 20 µg/ml), Trichoderma hamatum (IC50: 2 µg/ml), Trichoderma hamatum (IC50: 4 µg/ml), Trichoderma hamatum (IC50: 2 µg/ml), Trichoderma hamatum (IC50: 3 µg/ml), Trichoderma hamatum (IC50: >100 µg/ml), Verticillium dahliae (IC50: 1.5 µg/ml), Verticillium dahliae (IC50: 50 µg/ml), Venturia inaequalis (IC50: 25 µg/ml), Venturia inaequalis (IC50: >50 µg/ml), Agrobacterium tumefaciens, Alcaligenes eutrophus, Azospirillum brasilense, Erwinia carotovora, Pseudomonas solanAngiotensin Converting Enzymearum, Bacillus megaterium, Sarcina lutea
IC50 value	10 µg/ml | 100 µg/ml | 3 µg/ml | 10 µg/ml | 1.5 µg/ml | 6 µg/ml | 5 µg/ml | 5.1 µg/ml | 11 µg/ml | 5 µg/ml | 5 µg/ml | 12 µg/ml | >100 µg/ml | 1.5 µg/ml | 12 µg/ml | 30 µg/ml | >100 µg/ml | 1.5 µg/ml | 6 µg/ml | 12 µg/ml | >100 µg/ml | 2 µg/ml | 20 µg/ml | 2 µg/ml | >100 µg/ml | 2 µg/ml | 5 µg/ml | 2 µg/ml | >100 µg/ml | 0.4 µg/ml | 7 µg/ml | 1.5 µg/ml | 50 µg/ml | 4 µg/ml | 50 µg/ml | 2 µg/ml | 3 µg/ml | 3 µg/ml | >100 µg/ml | 2 µg/ml | 5 µg/ml | 2 µg/ml | >100 µg/ml | 1.5 µg/ml | 10 µg/ml | 2 µg/ml | 30 µg/ml | 1 µg/ml | 6 µg/ml | 25 µg/ml | >100 µg/ml | 1.5 µg/ml | 7 µg/ml | >100 µg/ml | >100 µg/ml | 15 µg/ml | 20 µg/ml | 2 µg/ml | 4 µg/ml | 2 µg/ml | 3 µg/ml | >100 µg/ml | 1.5 µg/ml | 50 µg/ml | 25 µg/ml | >50 µg/ml
Sequence	XKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Sequence Length	51
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	5718.85
Monoisotopic Molecular Weight (Da)	5714.83
Isoelectric Point (pI)	9.08
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_2047

External links (Uniprot, PDB and Source Information Database)
Uniprot	P30230
NCBI	--NA--
EMBL	--NA--
Link to Source Databases	DBAASP_1926
Addtional Information	Synthesis Type : Ribosomal