Detailed Peptide Information


This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking



Primary Information
PPepDB IDPPepDB_2046
Peptide NameDefensin-like protein 4
PMID(s)7780308
Plant Source (Scientific Name)Raphanus sativus
Plant Source (Common Name)Radish
Plant FamilyBrassicaceae
Peptide FamilyDefensin
Peptide FunctionAntifungal
Peptide Function DescriptionTarget site: lipid bilayer
Activity AgainstAlternaria brassicicola (IC50: 5 µg/ml), Botrytis cinerea (IC50: 9 µg/ml), Fusarium culmorum (IC50: 11 µg/ml)
IC50 value5 µg/ml | 9 µg/ml | 11 µg/ml
SequenceXKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
Sequence Length51
ValidationProtein inferred from homology
Average Molecular Weight (Da)5730.73
Monoisotopic Molecular Weight (Da)5726.71
Isoelectric Point (pI)8.51
Method / Extraction--NA--


Secondary Information
Tertiary Structure and DSSP ReportClick to View Structure
Physico-Chemical Properties of peptidesClick to View Physico-Chemical Details of PPepDB_2046


External links (Uniprot, PDB and Source Information Database)
UniprotO24331
NCBI--NA--
EMBL--NA--
Link to Source DatabasesDBAASP_1965
Addtional InformationSynthesis Type : Ribosomal