Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_2044
Peptide Name	Defensin-like protein 1 / Rs-AFP1
PMID(s)	8422949, 1639777
Plant Source (Scientific Name)	Raphanus sativus, Sinapis alba, Brassica juncea, Brassica rapa subsp. pkinensis
Plant Source (Common Name)	Radish, White mustard, brown mustard, Turnip
Plant Family	Brassicaceae
Peptide Family	Defensin
Peptide Function	Antibacterial, Antifungal, Hemolytic, Cytotoxic
Peptide Function Description	Target site: lipid bilayer; Not active up to 500 µg/ml against Human endothelial cells, Human fibroblasts
Activity Against	Alternaria brassicicola (IC50: 15 µg/ml), Alternaria brassicicola (IC50: >100 µg/ml), Botrytis cinerea (IC50: 8 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Fusarium culmorum (IC50: 5 µg/ml), Fusarium culmorum (IC50: 70 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: 30 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: >100 µg/ml), Pyricularia oryzae (IC50: 0.3 µg/ml), Pyricularia oryzae (IC50: >100 µg/ml), Verticillium dahliae (IC50: 5 µg/ml), Verticillium dahliae (IC50: >100 µg/ml), Ascochyta pisi (IC50: 5 µg/ml), Ascochyta pisi (IC50: >100 µg/ml), Cercospora beticola (IC50: 2 µg/ml), Cercospora beticola (IC50: 100 µg/ml), Colletotrichum lindemuthianum (IC50: 100 µg/ml), Colletotrichum lindemuthianum (IC50: >100 µg/ml), Fusarium culmorum (IC50: 5 µg/ml), Fusarium culmorum (IC50: 6 µg/ml), Fusarium culmorum (IC50: 11 µg/ml), Fusarium culmorum (IC50: >100 µg/ml), Fusarium oxysporum f. sp. pisi (IC50: 15 µg/ml), Fusarium oxysporum f. sp. pisi (IC50: >100 µg/ml), Mycosphaerella fijiensis var. fijiensis (IC50: 4 µg/ml), Mycosphaerella fijiensis var. fijiensis (IC50: 30 µg/ml), Nectria haematococca (IC50: 6 µg/ml), Nectria haematococca (IC50: >100 µg/ml), Phoma betae (IC50: 2 µg/ml), Phoma betae (IC50: 20 µg/ml), Phytophthora infestans (IC50: 3 µg/ml), Phytophthora infestans (IC50: >100 µg/ml), Pyrenophora tritici-repentis (IC50: 3 µg/ml), Pyrenophora tritici-repentis (IC50: 30 µg/ml), Pyricularia oryzae (IC50: 0.3 µg/ml), Pyricularia oryzae (IC50: >100 µg/ml), Rhizoctonia solani (IC50: 100 µg/ml), Rhizoctonia solani (IC50: >100 µg/ml), Sclerotinia sclerotiorum (IC50: 20 µg/ml), Sclerotinia sclerotiorum (IC50: >100 µg/ml), Septoria nodorum (IC50: 20 µg/ml), Septoria nodorum (IC50: 100 µg/ml), Trichoderma hamatum (IC50: 6 µg/ml), Trichoderma hamatum (IC50: 20 µg/ml), Trichoderma hamatum (IC50: 6 µg/ml), Trichoderma hamatum (IC50: 35 µg/ml), Trichoderma hamatum (IC50: >100 µg/ml), Verticillium dahliae (IC50: 5 µg/ml), Verticillium dahliae (IC50: >100 µg/ml), Agrobacterium tumefaciens, Alcaligenes eutrophus, Azospirillum brasilense, Erwinia carotovora, Pseudomonas solanAngiotensin Converting Enzymearum, Bacillus megaterium, Sarcina lutea
IC50 value	15 µg/ml | >100 µg/ml | 8 µg/ml | >100 µg/ml | 5 µg/ml | 70 µg/ml | 30 µg/ml | >100 µg/ml | 0.3 µg/ml | >100 µg/ml | 5 µg/ml | >100 µg/ml | 5 µg/ml | >100 µg/ml | 2 µg/ml | 100 µg/ml | 100 µg/ml | >100 µg/ml | 5 µg/ml | 6 µg/ml | 11 µg/ml | >100 µg/ml | 15 µg/ml | >100 µg/ml | 4 µg/ml | 30 µg/ml | 6 µg/ml | >100 µg/ml | 2 µg/ml | 20 µg/ml | 3 µg/ml | >100 µg/ml | 3 µg/ml | 30 µg/ml | 0.3 µg/ml | >100 µg/ml | 100 µg/ml | >100 µg/ml | 20 µg/ml | >100 µg/ml | 20 µg/ml | 100 µg/ml | 6 µg/ml | 20 µg/ml | 6 µg/ml | 35 µg/ml | >100 µg/ml | 5 µg/ml | >100 µg/ml
Sequence	XKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Sequence Length	51
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	5677.75
Monoisotopic Molecular Weight (Da)	5673.76
Isoelectric Point (pI)	8.72
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_2044

External links (Uniprot, PDB and Source Information Database)
Uniprot	P30231, E3WAM6, P69241, A7X6E0, M4CVH9, Q003I3
NCBI	--NA--
EMBL	--NA--
Link to Source Databases	DBAASP_1935
Addtional Information	Synthesis Type : Ribosomal