Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2040 |
| Peptide Name | Antimicrobial peptide 1, MJ-AMP1, AMP1 |
| PMID(s) | 1733929 |
| Plant Source (Scientific Name) | Mirabilis jalapa |
| Plant Source (Common Name) | Garden four-o'clock |
| Plant Family | Nyctaginaceae |
| Peptide Family | --NA-- |
| Peptide Function | Antibacterial, Antifungal, Hemolytic, Cytotoxic |
| Peptide Function Description | Target site: lipid bilayer; 6% Killing against Human endothelial cells at 500 µg/ml; 2% killing against Human fibroblasts at 500 µg/ml |
| Activity Against | Alternaria brassicicola (IC50: 20 µg/ml), Ascochyta pisi (IC50: 200 µg/ml), Botrytis cinerea (IC50: 60 µg/ml ), Cercospora beticola (IC50: 10 µg/ml), Colletotrichum lindemuthianum (IC50: 6 µg/ml), Fusarium culmorum (IC50: 30 µg/ml ), Fusarium oxysporum f. sp. pisi (IC50: 15 µg/ml), Fusarium oxysporum f. sp. lycopersici (IC50: 200 µg/ml ), Nectria haematococca (IC50: 15 µg/ml ), Phoma betae (IC50: 25 µg/ml), Pyrenophora tritici-repentis (IC50: 300 µg/ml), Pyricularia oryzae (IC50: 6 µg/ml), Rhizoctonia solani (IC50: 60 µg/ml), Verticillium dahliae (IC50: 12 µg/ml), Venturia inaequalis (IC50: 12 µg/ml), Bacillus megaterium (IC50: 6 µg/ml ), Sarcina lutea (IC50: 100 µg/ml), Escherichia coli (IC50: >500 µg/ml), Erwinia carotovora (IC50: >500 µg/ml ) |
| IC50 value | 20 µg/ml | 200 µg/ml | 60 µg/ml | 10 µg/ml | 6 µg/ml | 30 µg/ml | 15 µg/ml | 200 µg/ml | 15 µg/ml | 25 µg/ml | 300 µg/ml | 6 µg/ml | 60 µg/ml | 12 µg/ml | 12 µg/ml | 6 µg/ml | 100 µg/ml | >500 µg/ml | >500 µg/ml |
| Sequence | XCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR |
| Sequence Length | 37 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3983.71 |
| Monoisotopic Molecular Weight (Da) | 3980.91 |
| Isoelectric Point (pI) | 8.66 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P25403 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_1642 |
|---|
| Addtional Information | Synthesis Type : Ribosomal |
