Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_1564 |
| Peptide Name | Alpha-purothionin, Purothionin AII |
| PMID(s) | 914810, 5031563 |
| Plant Source (Scientific Name) | Triticum aestivum |
| Plant Source (Common Name) | Wheat |
| Plant Family | Poaceae |
| Peptide Family | Thionin |
| Peptide Function | Antibacterial, Toxin |
| Peptide Function Description | is toxic to animal cells |
| Activity Against | Pseudomonas solanAngiotensin Converting Enzymearum ( MIC = 3 µg/ml ), Xanthomonas phaseoli ( MIC = 6 µg/ml ) |
| IC50 value | --NA-- |
| Sequence | KSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPK |
| Sequence Length | 45 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 4825.78 |
| Monoisotopic Molecular Weight (Da) | 4822.36 |
| Isoelectric Point (pI) | 9.75 |
| Method / Extraction | X-ray |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P01544 |
| NCBI | 350008 |
| EMBL | --NA-- |
| Link to Source Databases | CAMPSQ3709, APD_02040, EROP-Moscow_01911 |
| Addtional Information | Antimicrobial activity was observed as early as 1895 and the protein components crystallized in 1941. However, these effects are due to a mixture of purothionins till 1972. In this 1974 study, antibacterial activity of both mixture and separated alpha and beta-thionins were evaluated. In particular, the peptide showed activity against pathogens of plant origin. Amino acid sequence was reported in 1977 (J Biochem). Refined crystal structure was reported in 1995 (see the PDB link). You can rotate, zoom, and view the tetrameric crystal structure here in the PDB. Updated 2/2014; Ref updated 3/2015. |