Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_1563 |
| Peptide Name | Sm-AMP-D1 |
| PMID(s) | 21056078 |
| Plant Source (Scientific Name) | Stellaria media |
| Plant Source (Common Name) | Chickweed |
| Plant Family | Caryophyllaceae |
| Peptide Family | Defensin |
| Peptide Function | Antimicrobial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Bipolaris sorokiniana (IC50: 0.5 µM), Fusarium oxysporum (IC50: 0.35 µM), Fusarium graminearum (IC50: 0.52 µM), Fusarium avenAngiotensin Converting Enzymeum (IC50: 0.52 µM), Botrytis cinerea (IC50: 1.0 µM), Phoma betae (IC50: 0.52 µM), Pythium debaryanum (IC50: 1.0 µM) |
| IC50 value | 0.5 µM | 0.35 µM | 0.52 µM | 0.52 µM | 1.0 µM | 0.52 µM | 1.0 µM |
| Sequence | KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFDC |
| Sequence Length | 50 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5763.49 |
| Monoisotopic Molecular Weight (Da) | 5759.36 |
| Isoelectric Point (pI) | 6.86 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | CAMPSQ3494, APD_01772, DBAASP_5812 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; The two Sm-AMP-D peptides differ only at one residue (N vs. D). It is uncertain whether the D form resulted from deamidation during purification. Provided by Biswajit Mishra. |
