<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP34037
| Description |
Uncharacterized protein |
| Sequence | MDKHQKIISEILRSYRDLMNCVTVNGMDKEKQGDYEAQANKLNYRDPDTMAAAGLRTQRKFDELYESIKELLALTRTIKELWVFGPVDRADEHRKEKEEQIDRDVAEITTLFNKIDANAMRELAEKNGGTWESQGEAAATAAAAAAAPPATTTAQAPEAPAPTGN |
| Length | 165 |
| Position | Head |
| Organism | Fusarium oxysporum f. sp. raphani 54005 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium oxysporum species complex.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.727 |
| Instability index | 26.59 |
| Isoelectric point | 4.98 |
| Molecular weight | 18296.24 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP34037
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.39| 21| 27| 15| 36| 1
---------------------------------------------------------------------------
15- 36 (35.70/25.43) YRDlMNCVTVNGMDKEKQGD..YE
44- 66 (33.70/19.55) YRD.PDTMAAAGLRTQRKFDelYE
---------------------------------------------------------------------------
|