<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP34024

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMSDPAGEIVHITQGYIPLSKVLTRLAQSTHNALQDQIAALAKMPLPAAAMNGNSTVLNSDVEDGSGENIAKKTSILNFAMREHRKWVKALVITEWSRKADMVSKLIDLRFHLQGQEVLFSGALDVMGHVKRDLTFARMPSPDLKTALQVLSTGEAAWMPDLSYIEPPPLTRQEQIQWISDLDTQLSLRLNLEDFDKIPYHFRNYEIDSGRVTFKVAGEFEVDLTIADEDFEKQFWFIDFRFAFEPAASSIPDGLKNYLEGQVNDILSKDGLLGCYQFLHELVLTHKLNELKRQAIQLSRGSWTGTLKVEPLNRALAIQYWTSRAQLGSPKSWILIAVNSGRKPNGQPDPKSSSHLMVKWYRDNKEVKDTNISFDADNLSAETLLKTVIGRHVEFLLGSIHSRLQAFPRFQNRDAAMILNISHDDPATSFLSMQVGYKDSASLLVEPTTGVFAVKPHSKFTIQHEHLLNNGKNPADDGATCLENVRCGVMEDELIRRGSTTGWNTKKSPLSKDELRSLTNTREWTKTIWLQRTGWDPNWFVMVMLSPSGDAWWLVDASRNANGQSNRLSSKLPLNKGYPHLEDEFWNNLTLFATGMIAQAVDQHELYRHNIKFLLQDTRNWSLPQQVRLPTLEISLSDIFPSMVFNMAEKDNAKAANESNAGTETARLGPVAPTASTPGISTRQPWAHDIVSIRFKGVEPVDKEASGAGGPISDVSFMCISDAIIKVRKPTKFAMLKGHMVGRDVSWKARTGEFCLRMRSNIGLSILENLKARVKAVDRFVSFFESLDKARGFIKAESVSLKEVTFSYGPPASQTVEDAEVSRLWRVALNLSNNDIDIQVQETNPHLPVTDLMQKLVNGANGIGALMDWLPVSLPTMEAFKKIREAWSDIEARRQGRFKFIMNSTDEMSFQYLLAGTGPGNQQVQRSITFLGQIKQRRGEPWWHIERKIPSSGWPSLNDEFSAALKPVWDGKGDDWSGLVTGATGRPENGIIGLLLAIDEAIRPLAGSTFQNNSEVVILE
Length1019
PositionTail
OrganismFusarium oxysporum f. sp. raphani 54005
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium oxysporum species complex.
Aromaticity0.08
Grand average of hydropathy-0.322
Instability index33.09
Isoelectric point6.46
Molecular weight114122.58
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP34024
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     151.76|      44|     425|     533|     587|       2
---------------------------------------------------------------------------
  537-  581 (75.69/70.03)	NWFVMVMLSPSGDAWWLVDASRNANGQSNRlSSKLPLNKGYPHLE
  589-  632 (76.07/39.30)	TLFATGMIAQAVDQHELYRHNIKFLLQDTR.NWSLPQQVRLPTLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     168.58|      37|     200|     669|     705|       7
---------------------------------------------------------------------------
  669-  705 (65.36/34.41)	P....VA.PTASTPG.ISTR..QPWAHDIVS...IRFKGVEPVDKEAS
  870-  908 (50.73/25.23)	P....VSlPTMEAFK..KIR..EAWS.DIEArrqGRFKFIMNSTDEMS
  918-  961 (52.49/26.33)	PgnqqVQ.RSITFLGqIKQRrgEPWWHIERK...IPSSGWPSLNDEFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.12|      10|      33|     192|     201|       8
---------------------------------------------------------------------------
  192-  201 (21.68/14.65)	EDFDK....IPYHF
  228-  241 (14.44/ 7.29)	EDFEKqfwfIDFRF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.92|      13|      18|     490|     505|      11
---------------------------------------------------------------------------
  490-  502 (23.88/ 8.89)	EDELIRRGSTTGW
  511-  523 (22.04/11.65)	KDELRSLTNTREW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.25|      20|      25|     132|     151|      15
---------------------------------------------------------------------------
  132-  151 (34.31/21.97)	DLTFARMPSPDLKTALQVLS
  160-  179 (34.95/22.52)	DLSYIEPPPLTRQEQIQWIS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP34024 with Med14 domain of Kingdom Fungi

Unable to open file!