| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADQEQLQQLPEAPFPAPPPFWKHFTVANEEQLKKSETAEGSLPLPLAYLRPPPPPPDSAEYYTTFGQKQVVDPTRPSSLPRDQLLFNPDDPNLNHAVILSRLTKSLLLNFLELTSILSLDPTKHAEKMEDIRQLVLNIHVVINVYRPHQARESVKELLEAVLENGQREIEECDRLKERVDEFLGNVGELKTTNVVEGPTQEDSAARQLSNDAKLEEQRQLWKLIHEMAD |
| Length | 230 |
| Position | Middle |
| Organism | Capronia epimyces CBS 606.96 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.605 |
| Instability index | 53.80 |
| Isoelectric point | 4.90 |
| Molecular weight | 26209.32 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP34015
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 112.29| 30| 35| 10| 44| 1
---------------------------------------------------------------------------
14- 44 (53.89/39.47) PFPAPPPFWKHFTVANEEQLkKSETAEGSLP
52- 81 (58.39/29.53) PPPPPPDSAEYYTTFGQKQV.VDPTRPSSLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.40| 16| 25| 122| 137| 2
---------------------------------------------------------------------------
122- 137 (26.42/16.19) PTKHAEKMEDIRQLVL
148- 163 (24.99/15.00) PHQARESVKELLEAVL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EYYTTF 2) PFWKHFTVANEE 3) TAEGSLPLPLAYLRP | 61 20 38 | 66 31 52 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab