| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDSVVLNPLNSLETHLNALITSLTQTNTFSNAPQITKDLLSDDYNLTESLNILQRHQQNYARTLDLRAEVASLQEQLKDTIKKCVALRQEIGQIHPSIVDSVDSDDEEEQEIGAKVAEVDYQTLLAFAARIGRHNAAAAREAEAEAIRRKVAARNNTTSATATTNGVSDSGAQTAGHENATAETEAELERIHNTIALTRAQMGMAFPDANMLRIGALGQLQLFQERQQHASNGDEEVQAAVEREVERMVRETEDVAEAEVEHGAEEEGDDDDNNLGSWPSPEMSRRSIGGTGTGMPAAVQQSASQPSQSRAAVPAASAPAPKRKLDLDFPSSDDDDDED |
| Length | 339 |
| Position | Middle |
| Organism | Capronia coronata CBS 617.96 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.648 |
| Instability index | 54.32 |
| Isoelectric point | 4.48 |
| Molecular weight | 36753.63 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP34012
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 57.45| 15| 18| 89| 103| 1
---------------------------------------------------------------------------
69- 82 (14.18/ 7.11) .EVASLQEQLKDTIK
89- 103 (25.91/18.46) QEIGQIHPSIVDSVD
110- 120 (17.36/10.19) QEIG....AKVAEVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.77| 16| 55| 176| 191| 2
---------------------------------------------------------------------------
131- 146 (24.90/12.55) I........GRHNAAAAREAEAEA
167- 190 (18.87/ 7.87) VsdsgaqtaGHENATAETEAELER
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GMPAAVQQSASQPSQSRAAVPAASAPAPKRKLDLDFPSSDDDDDED 2) LGSWPSPEMSRRSIGGT | 294 275 | 339 291 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab