Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDSVVLNPLNSLETHLNALITSLTQTNTFSNAPQITKDLLSDDYNLTESLNILQRHQQNYARTLDLRAEVASLQEQLKDTIKKCVALRQEIGQIHPSIVDSVDSDDEEEQEIGAKVAEVDYQTLLAFAARIGRHNAAAAREAEAEAIRRKVAARNNTTSATATTNGVSDSGAQTAGHENATAETEAELERIHNTIALTRAQMGMAFPDANMLRIGALGQLQLFQERQQHASNGDEEVQAAVEREVERMVRETEDVAEAEVEHGAEEEGDDDDNNLGSWPSPEMSRRSIGGTGTGMPAAVQQSASQPSQSRAAVPAASAPAPKRKLDLDFPSSDDDDDED |
Length | 339 |
Position | Middle |
Organism | Capronia coronata CBS 617.96 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.648 |
Instability index | 54.32 |
Isoelectric point | 4.48 |
Molecular weight | 36753.63 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP34012 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 57.45| 15| 18| 89| 103| 1 --------------------------------------------------------------------------- 69- 82 (14.18/ 7.11) .EVASLQEQLKDTIK 89- 103 (25.91/18.46) QEIGQIHPSIVDSVD 110- 120 (17.36/10.19) QEIG....AKVAEVD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.77| 16| 55| 176| 191| 2 --------------------------------------------------------------------------- 131- 146 (24.90/12.55) I........GRHNAAAAREAEAEA 167- 190 (18.87/ 7.87) VsdsgaqtaGHENATAETEAELER --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GMPAAVQQSASQPSQSRAAVPAASAPAPKRKLDLDFPSSDDDDDED 2) LGSWPSPEMSRRSIGGT | 294 275 | 339 291 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab