<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP34010
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPKLTLKMSRGVRGATSVSEPTNTNDHSILAPPDSDRTRAQRARSGAGEPIRTAAGDTGRTRTPELEEDVTEEHSRPASTFITLRIPPERLHQTDRSIPSTGSFITRKVSKRSRRAAVQNPSSPSGVSHPSPHSLLSDTASTFAGTEVDYAQETPATVESPPQLYPNDDYSQSGLTESDILQHRARSGPFNQIGLSHTTTTTDHRPATPTEVFDSGQIDPTIDPALYQLHAESQTMAPVKDTTNVHNTIKDIIQDLTEIQIQTHGYVPETQDLLVEKMTDLAESLSRLQNLTSATASPNSYIHQVQIAPEIVDYVDDGRNPDIFTRDFVENVQRGNAVINGKQQAFKDFSEIYAKALKEGIPGLGRQVDQVLENAGFEIDHKQEGEDEVVDHSNPNGPQMSDGV |
| Length | 405 |
| Position | Middle |
| Organism | Capronia coronata CBS 617.96 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.722 |
| Instability index | 51.39 |
| Isoelectric point | 5.04 |
| Molecular weight | 44301.07 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP34010
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.72| 19| 20| 82| 101| 1
---------------------------------------------------------------------------
82- 101 (29.09/24.34) FITLRIpPERLHQTDRSIPS
105- 123 (31.64/20.40) FITRKV.SKRSRRAAVQNPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 209.94| 63| 176| 124| 221| 2
---------------------------------------------------------------------------
16- 79 (103.06/66.57) ATSVSEPT..NTNDHSILAPPDSDRTRaQRARSGAGEPIRTAAGDTGRTRTPELEEDVTEEHSRPA
157- 221 (106.87/43.27) ATVESPPQlyPNDDYSQSGLTESDILQ.HRARSGPFNQIGLSHTTTTTDHRPATPTEVFDSGQIDP
---------------------------------------------------------------------------
|