<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33997

Description Mediator of RNA polymerase II transcription subunit 10
SequenceMGPKLLLKMGQGGRGATNTNNNSGPAPPNNGQTRGQRTRSGVRRPVQKPAGDTRIIRTPEDEGAQEQTERPSSTFITIRLTSERLRQVLQSTASSGPFITLKVPRRGRRSAVGKPSSPPEVSGSSPPSLLSGAASTFSEVQSDYGQATPVANEPSPQLYQTYDEQQAVLANCAIIQDPIFSGLLDQAKLLQIPAAECRRATTPDWRVSGQIDSTLDPALYRIAPRHQVMAPVKDTSSVHNTIKDIIQDLTEIQIQTHGYVPETQDLLVDKMTDLAESLSRLQNLTSATASPNNYIQHVQIAPEIVDYVDDGRNPDIFTRDFVENVQRGNAVINGKQQAFKDFSEIYAKALKEGIPGVSRQVDRVLESAGFEIEQKNEGDGPSYSTSNGPHVPDGV
Length395
PositionMiddle
OrganismCapronia epimyces CBS 606.96
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia.
Aromaticity0.05
Grand average of hydropathy-0.604
Instability index52.26
Isoelectric point5.85
Molecular weight42919.27
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33997
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      87.14|      19|      19|      31|      49|       1
---------------------------------------------------------------------------
   10-   29 (27.38/13.05)	GQgGRGATNT..NNNSGPAPPN
   31-   49 (33.48/17.53)	GQ.TRGQRTR..SGVRRPVQKP
   51-   71 (26.29/12.25)	GD.TRIIRTPedEGAQEQTERP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.65|      15|      20|      72|      87|       2
---------------------------------------------------------------------------
   72-   87 (20.85/21.00)	SSTFITIRLtSERLRQ
   95-  109 (27.80/21.92)	SGPFITLKV.PRRGRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.91|      12|      20|     310|     323|       3
---------------------------------------------------------------------------
  310-  323 (13.77/21.83)	DGRNpDIFtRDFVE
  333-  344 (22.14/16.50)	NGKQ.QAF.KDFSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     132.87|      40|     149|     195|     236|       4
---------------------------------------------------------------------------
  195-  236 (65.56/49.86)	AECRRATTPDwrVSGQIDSTLDPALYRIAPRHQVMAPVKDTS
  347-  386 (67.31/43.36)	AKALKEGIPG..VSRQVDRVLESAGFEIEQKNEGDGPSYSTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      27.96|       9|      19|     143|     152|       5
---------------------------------------------------------------------------
  143-  152 (12.30/12.07)	DYGQATpVAN
  163-  171 (15.67/ 8.48)	DEQQAV.LAN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33997 with Med10 domain of Kingdom Fungi
Unable to open file!