Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MGPKLLLKMGQGGRGATNTNNNSGPAPPNNGQTRGQRTRSGVRRPVQKPAGDTRIIRTPEDEGAQEQTERPSSTFITIRLTSERLRQVLQSTASSGPFITLKVPRRGRRSAVGKPSSPPEVSGSSPPSLLSGAASTFSEVQSDYGQATPVANEPSPQLYQTYDEQQAVLANCAIIQDPIFSGLLDQAKLLQIPAAECRRATTPDWRVSGQIDSTLDPALYRIAPRHQVMAPVKDTSSVHNTIKDIIQDLTEIQIQTHGYVPETQDLLVDKMTDLAESLSRLQNLTSATASPNNYIQHVQIAPEIVDYVDDGRNPDIFTRDFVENVQRGNAVINGKQQAFKDFSEIYAKALKEGIPGVSRQVDRVLESAGFEIEQKNEGDGPSYSTSNGPHVPDGV |
Length | 395 |
Position | Middle |
Organism | Capronia epimyces CBS 606.96 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.604 |
Instability index | 52.26 |
Isoelectric point | 5.85 |
Molecular weight | 42919.27 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33997 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 87.14| 19| 19| 31| 49| 1 --------------------------------------------------------------------------- 10- 29 (27.38/13.05) GQgGRGATNT..NNNSGPAPPN 31- 49 (33.48/17.53) GQ.TRGQRTR..SGVRRPVQKP 51- 71 (26.29/12.25) GD.TRIIRTPedEGAQEQTERP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.65| 15| 20| 72| 87| 2 --------------------------------------------------------------------------- 72- 87 (20.85/21.00) SSTFITIRLtSERLRQ 95- 109 (27.80/21.92) SGPFITLKV.PRRGRR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.91| 12| 20| 310| 323| 3 --------------------------------------------------------------------------- 310- 323 (13.77/21.83) DGRNpDIFtRDFVE 333- 344 (22.14/16.50) NGKQ.QAF.KDFSE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 132.87| 40| 149| 195| 236| 4 --------------------------------------------------------------------------- 195- 236 (65.56/49.86) AECRRATTPDwrVSGQIDSTLDPALYRIAPRHQVMAPVKDTS 347- 386 (67.31/43.36) AKALKEGIPG..VSRQVDRVLESAGFEIEQKNEGDGPSYSTS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 27.96| 9| 19| 143| 152| 5 --------------------------------------------------------------------------- 143- 152 (12.30/12.07) DYGQATpVAN 163- 171 (15.67/ 8.48) DEQQAV.LAN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IIRTP 2) MGPKLLLKMG 3) PFITLKV | 55 1 97 | 59 10 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab