<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33996

Description Uncharacterized protein
SequenceMTHNPPAAARPPPPRRPPDTHRLSLDRSTTRIIPPIDGRPLGLQRQVGQLGGDRPAKRRKVEGDEPTSLGSGASDKAPAATSPKSLSNAKAYHLRLLKPSVLGSRQKEDVKSVNGDLPDLPARPWHHAEHYNATEEPKPTHRSRVKLPVPTTPDSLQLPSSAPYIVPKKPAGFFPWTGKHPEDVLSDVNVKQGFFDKPPNPPEKELNTARVPLYNAFKHKSGVENLSILFSLVLDQKNQHGLISSASTFKPPPRVTLTEAKRKSWIADLANADVPLRKLSRTIPQGIRGQILLDLCLQSCVPLNRAVWFAKCVCANEIRTLKRKGTTPAVAVGAESKWIREWTVNVEQFVETHLEPTDHPDWRSNIQYALHLTTRLYMEHLLDRDHYLDWIVRSFHLADLGHTPFWLMVMHIHQEDICHFRKLGGRLAEVLVEKFELVNKPLAENTAPLRQKLYHTIRWLLHSRPVSFLMPEKWPQAVVSVRSCLDTKVLAERQMLDQLNRINARTMGHNKHAYTAKRSTHQVIVEVLDSAQPPYDLPKLAESLSAACSDIPRLIFTCLEWTCTRFRQSKSRIFLFARLAKRWQSAGHDVDNVILNYLSACRKGDISADGKPLQHLAAQLSRSGLFPLSKYIQWLMVRGLPKKRGMVTCLEPMSVAAGPGALPMEADPSQLLLHVSLQNVEQHVINLRNSILRGSGFDPDVEDNVYQDCVGFLEQELALLDRGPKPSEPRIPTPAFASLPWTVRSRLAIWLRTKVAARAKARVNVPCAPAGVNLLGSRILDVDQFAFVRNVLECMEDDAVLADVIGILSCSQDDDLIASLVATLCFHADAFSAIGALEVLQRRACQIYLGWRTIRPTMPLFTSSLLDLCTAYPMKTPTTRLLQQDFVRGDRGRAVAACSPYSDGIAESLQQAGATFVEDFEAILQSEHNMNEQTMNGLFSVLVDRIEKQLKFGYSSTTVASFCQLLSRLRLCRKAQGDLLIGRWMAQLVPSIDATFGSLLLQNLIGTGCLTFSGLFEAARTPNSGLSQSSATRSLLQHLITPPPGSLADIVLYRTQSRWFEYIQRESRSVLELLCEMGLESTSFPLEETLLDCLVKDDTIRSSPMSHPAEQWLLKALNRSLRCQERPIRNEDIRALVSSINVFSHRFVQLRLWLTSRSGPESSLAPDEDELVKALSEALEQMLQDPAGNKEGDVWFTQLLDAVEVNVANRLRHQVENEFLGALPKFQLNKATTSLPCVFSGDVHHLSSIMERAYLLCTKSTSPTLGFLPLLIDKLTQHLKALGSTSSAMALSTSAGISGSPQNTNHPPLTSVTPSPIANITSEGGHSVFPGMILDCLHHLLQMLCLQRVALRDTGPAGLNPKQAQSEQVQLLVRLAWIATHPAITSAPTNLTSKEDQQKAKDVLEFTFDVIATMMDEVSDDVRMMSAKILKDKLQDARMKYLFGSVNIMGSAQVRDLGQGLQIIKEAKGSLGDWKPRVWEILDNGSGKESETSLGLGLFGARHK
Length1504
PositionKinase
OrganismCapronia epimyces CBS 606.96
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia.
Aromaticity0.06
Grand average of hydropathy-0.222
Instability index52.25
Isoelectric point8.77
Molecular weight167245.51
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33996
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.34|      25|      28|       5|      31|       1
---------------------------------------------------------------------------
    5-   31 (42.49/26.60)	PPAAARPPPPRRppDTHRLSLDRSTTR
   34-   58 (46.85/22.89)	PPIDGRPLGLQR..QVGQLGGDRPAKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.79|      24|      30|    1342|    1367|       2
---------------------------------------------------------------------------
 1342- 1365 (43.84/26.22)	QMLCLQRVALRDTGPA......GLNPKQAQ
 1368- 1397 (35.95/15.04)	QVQLLVRLAWIATHPAitsaptNLTSKEDQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.86|      19|      36|    1000|    1034|       4
---------------------------------------------------------------------------
 1000- 1021 (30.45/43.97)	LLQNLI..GTGCLTFSGLFeaaRT
 1035- 1055 (30.42/ 9.06)	LLQHLItpPPGSLADIVLY...RT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     143.35|      41|      50|     118|     164|       5
---------------------------------------------------------------------------
  118-  158 (77.04/52.90)	PDLPARPWHHAEHYNATEEPKPTHRSRVKLPVPTTPDSLQL
  734-  774 (66.31/33.34)	PAFASLPWTVRSRLAIWLRTKVAARAKARVNVPCAPAGVNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.21|      19|      20|     172|     190|       6
---------------------------------------------------------------------------
  172-  190 (37.06/20.75)	GFFPWTGKHPEDVLSDVNV
  193-  211 (36.15/20.06)	GFFDKPPNPPEKELNTARV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.67|      13|      26|    1456|    1472|       7
---------------------------------------------------------------------------
 1456- 1472 (18.84/23.62)	DLGQGlqiiKEAKGSLG
 1483- 1495 (23.83/16.17)	DNGSG....KESETSLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.06|      27|      31|    1260|    1290|       8
---------------------------------------------------------------------------
 1260- 1290 (40.39/29.83)	STSPTLGFLPllidKLTQHLKALGSTSSAMA
 1292- 1318 (48.67/26.99)	STSAGISGSP....QNTNHPPLTSVTPSPIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      76.76|      23|      26|    1083|    1105|       9
---------------------------------------------------------------------------
  443-  466 (17.67/ 7.19)	AEntaPLRQKLYH................TIRwllhSRPV
 1083- 1105 (39.48/26.55)	SF...PLEETLLDCL..........VKDDTIR....SSPM
 1106- 1134 (19.61/ 8.91)	SH...PAEQWLLKALnrslrcqerpIRNEDIR........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      71.07|      15|      51|     569|     583|      10
---------------------------------------------------------------------------
  569-  583 (25.19/13.39)	SKSRIFLFARLAKRW
  607-  620 (21.41/10.24)	SADGKPL.QHLAAQL
  621-  634 (24.46/12.78)	SRSGLFPLSKYIQ.W
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.54|      24|      26|     252|     276|      12
---------------------------------------------------------------------------
  252-  276 (37.69/27.61)	PPRvTLTEAKRKSWIADLA.NADVPL
  279-  303 (38.85/23.75)	LSR.TIPQGIRGQILLDLClQSCVPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.92|      14|      26|     869|     884|      13
---------------------------------------------------------------------------
  869-  884 (20.93/19.55)	CTAYpmKTPTTRLLQQ
  898-  911 (25.99/15.41)	CSPY..SDGIAESLQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.13|      17|      28|     794|     812|      14
---------------------------------------------------------------------------
  794-  812 (26.99/24.93)	CMEDDAVLAdvIGILSCSQ
  825-  841 (31.13/21.07)	CFHADAFSA..IGALEVLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.80|      13|     368|     594|     606|      15
---------------------------------------------------------------------------
  594-  606 (24.75/16.50)	ILNYLSACRK..GDI
  965-  979 (19.05/10.80)	LLSRLRLCRKaqGDL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33996 with Med12 domain of Kingdom Fungi
Unable to open file!