<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33995
| Description |
Uncharacterized protein |
| Sequence | METSSRRDNIPDAVPTAKFLQARITALSTTLIKRLENIFAVALDETAAEATNSATSGSQLPPSLTDTAVQQFQLDVESAAVIRAAEEIMMLTRTMKEIWLFGGLDTLEKDHDSDKNPEDEAVRRKVEEDVRVVEEGFKKFLEKYETSLDLDGQNP |
| Length | 155 |
| Position | Head |
| Organism | Capronia coronata CBS 617.96 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.453 |
| Instability index | 45.90 |
| Isoelectric point | 4.53 |
| Molecular weight | 17274.15 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33995
No repeats found
|