Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDSVVLDPLNSLETHLNSLVTSLTQTNAFTNAPQIAKDLILDDDNLTASLNLLQRHQQNYARILNLRSEVAGLQEQLRDTIKRCVALRQEIGQVHPSILNTLDSDEEEEEDYDDDQDAKVAEVDYHTLLAFAARIGKHNAVAAREAEAEAVKRKVAAKRKTSATTNGVPDSAGPATGNENGNGNATAETEAELERIHNTIALTRAQLGMAFPDANILRVGALGQLQLFQERQQHTSSGDEEVQAAVEREVERLVRASEDIAEAEVERTEEEEIGGTWPSPGMSRMSIGDEVKPAAPQASASQSLHTGAAAPASAQAPKRKLDLDFPSSDDEDEG |
Length | 334 |
Position | Middle |
Organism | Capronia epimyces CBS 606.96 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.588 |
Instability index | 54.19 |
Isoelectric point | 4.56 |
Molecular weight | 36160.24 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33988 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 197.09| 66| 69| 70| 136| 1 --------------------------------------------------------------------------- 70- 136 (103.01/52.38) VAGlQEQLRDTIKRCVALRQEIGQVHPSILNTLDSDEEEEEDYDDDQDAKVAEVD.YHTLLAFA.ARIG 141- 208 (94.07/44.44) VAA.REAEAEAVKRKVAAKRKTSATTNGVPDSAGPATGNENGNGNATAETEAELErIHNTIALTrAQLG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.29| 15| 16| 283| 298| 2 --------------------------------------------------------------------------- 283- 298 (21.82/16.62) SR.MSIGdEVKPAAPQA 301- 316 (19.48/ 9.67) SQsLHTG.AAAPASAQA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.77| 12| 16| 240| 251| 3 --------------------------------------------------------------------------- 240- 251 (19.32/11.14) EEV.QAAVEREVE 258- 270 (15.46/ 7.62) EDIaEAEVERTEE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IGDEVKPAAPQASASQSLHTGAAAPASAQAPKRKLDLDFPSSDDEDEG 2) KRKVAAK | 287 152 | 334 158 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab