<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33980
| Description |
Uncharacterized protein |
| Sequence | MAANYWTSTQRKYWTFTPEKLAEIRDDLDRQAAKAIEQHPYPDRRLMFIFLRDRLLQLAKRLPFRQQCVATALVYLHRYFLSTPMQNVNLYLLTATAFYLASKTEESPHHIRLVAAEARQAWPEFVPGDVSRLGEMEFCLISEMHSQLIVWHPYRSLIALKENQDLKLSNDELGLAWSIINDSYMTDLPLTCAPHLIAIIAMFLAVVFLPTAKAAGTLRPISHDTLANPDSGPFSSLVGRQALSGSFNAVIGNLQMSNHPGSQTNPAPNGKARASLNDSSSQRVDREKTIAAIKESEKLQNIMRFLVESGIDIEQMIESTQEMISLYDVWEQYSEKSIKDTVSRCLKSRALDN |
| Length | 353 |
| Position | Kinase |
| Organism | Capronia coronata CBS 617.96 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Capronia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.233 |
| Instability index | 46.14 |
| Isoelectric point | 6.52 |
| Molecular weight | 40020.37 |
| Publications | |
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
ECO:0000256 ARBA:ARBA00002306
ECO:0000256 ARBA:ARBA00003882
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33980
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.08| 31| 110| 11| 41| 2
---------------------------------------------------------------------------
11- 41 (56.82/38.65) RKYW.TFTP...EKLAEIRDDL.DRQAAKAIEQHPY
119- 154 (47.25/31.02) RQAWpEFVPgdvSRLGEMEFCLiSEMHSQLIVWHPY
---------------------------------------------------------------------------
|