Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MALTGVFILPIAPGQSSPSSALISHISRSFPAEPLPPFHLDHRHFVDTSHLLPNSDISQRKSASILTLSHTPSKTYVAISSPKEDSQAAEHLASPSLTTITIPSSSADPFTQLIGTKLQPQWAHRQSLVIDNGTALSLDGGEWTIRIGDLKTPSRPNQASSNLRGMVVEVSFVGSPADTTHNQSPDDAPKGVDGKVVSKEDETLLRGLLDSVTDGSGVPSIHNLETTRSLIRRTKAHATDIDTGDTSPDWDLAHLYLDVLRGSRG |
Length | 265 |
Position | Head |
Organism | Cladophialophora psammophila CBS 110553 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.329 |
Instability index | 53.56 |
Isoelectric point | 5.91 |
Molecular weight | 28368.30 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33972 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 149.28| 45| 80| 70| 117| 1 --------------------------------------------------------------------------- 70- 117 (70.88/49.18) HTPSKTYVAISSPKEDSQAAEHLASPSLTTitiPSSSADPFTQLIGTK 151- 195 (78.40/47.34) KTPSRPNQASSNLRGMVVEVSFVGSPADTT...HNQSPDDAPKGVDGK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DWDLAHLYLDVLRGSRG 2) MALTGV | 249 1 | 265 6 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab