Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPLTGLFIVTVGPGQSSPSGALISHISRSFPAQPLPTFSLDHRLFIDTSSLLPSSNASLRKSTSILTISHTPATTYVATTSPASQSKEQPAVAPSPTLITIPSTSADSFTQLIGTKFQPLWTHRQSLVIENGTALSFLDAEWIIRIGDLKTPPRANQAGSNLRGMLVEVSHIEDDGNMRSKGSGDVQKDGLDVDKEDEALLRGFLDSVTNGSGVPSITSSDSNRFLIRRTKVREMDKGAASPTANFEVASLYLDFLRGSRG |
Length | 261 |
Position | Head |
Organism | Cladophialophora yegresii CBS 114405 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.200 |
Instability index | 51.13 |
Isoelectric point | 6.52 |
Molecular weight | 27925.10 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33968 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.25| 13| 111| 101| 113| 2 --------------------------------------------------------------------------- 101- 113 (24.22/14.81) IPS.TSADSFTQLI 214- 227 (20.03/11.05) VPSiTSSDSNRFLI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FLIRR 2) LDFLR | 225 253 | 229 257 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab