Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAELTPDQVRSLDLTRQRLLALHQSLVSLRDSLGNANPVPSLPELQTHAQLISNNLQTITSQLAEAGDLLRSTVAFPTPRFPGMKSQNILDALLRSKFEPNIEDWVKEGEEIAAQQRKTSSRGLSESDRNELWQWAPGAANSAARKQTWGGDYTRAEVQAGIESVVTGLRRQLVEPPEGEDDEEAEDDEDEYEVTDEEDEGGAAMDVEKQQLKTESKSIPETQTAPPTAGLMPLASIHKFMTTGR |
Length | 245 |
Position | Head |
Organism | Cladophialophora yegresii CBS 114405 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.698 |
Instability index | 63.95 |
Isoelectric point | 4.54 |
Molecular weight | 27019.55 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33952 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 116.06| 36| 93| 99| 140| 2 --------------------------------------------------------------------------- 99- 140 (58.30/44.92) EPNIEDWVKEG...EEIAAQQRKTSSRGLSESdrnelwQWAPGAA 191- 229 (57.76/31.92) EYEVTDEEDEGgaaMDVEKQQLKTESKSIPET......QTAPPTA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AMDVEKQQLKTES 2) ASIHKFMTTGR | 204 235 | 216 245 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab