<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33951

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMTVSRWMTLARQCVIRRISVQQFSDLLRSHDNEIDGKRLFLGFLECRDFFCQPGDPLISLYVDYIAITGIIAISDALIILTKRWNDTKFPASRDTLACYNDTLQDLTMVVVSPKYKTTVSEARLALQISSRWLSALARQASRGDPEPSGLELNGTIELLAFLMASMAATDAGLEALSPPEGLRQKNKQGHVNDLGISVKQAFELCLPLYSMLSPQLMERINTVLKHINLLDDSPSQPGNARAPGSEIQALQFQVSIADSQLVASKAGTMLYLEGLLFTGSTIDDGGTVHWLSSRHQNDYQSMFSDIFTSSFSILKAQHTTPTRTLCVQQSQIFIQNKLPALLSMISASSFNSFSTEQAITEAWHQVMPLLSAQDLLLTGARFLHVCALHHLIPAQVAAQLVGSEDLLKGLNKGLYAKDDLVAQVNVNHIRGPKLVEELTRSDGSAGFISQAVVEIMHIYCQNKETQYLRDLANAILRRPAAINCIALFVRPSFFLGPLCGLLDEWRWDEIHEGEAQPVYDDFGAVFLLILISRARLALSNSSLGIRKKDGFLAQYLEQENNEESLESLSEEKKSHLGNWINALYLAEGLSDELFINCSPHDFYLLIPTLLRQSMTAHQQGKLTHDSLQAGLDYLLEPFLLPSLISAMNWAAEVFRHEPTVAGKVLEVLIKPPGSVESRDIHHTILAMCAPRLKMRLKAAGSQDTNADPILQILNQCPGFSLFSERDFEIPGPGVLDILQHSLVTLITSTATLDYGDQSTSRDISALVSRAVEVRGPHTTLRAIVGVLLQLSDSHVFLFALDALTTTVCMAGNGLRDALRLQYNDLGGLLKRGETLTAEGVVRLHRQVEAYTDLLGVPEMGLDSFTFTQQLTNMDTTNPNLDAATAVSGGMDIQTEQGQVDGIDQVLDEVAAMGNLDPNDADMSFDALYGLQGNDMDLNDLDLDNMF
Length946
PositionTail
OrganismCladophialophora psammophila CBS 110553
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora.
Aromaticity0.07
Grand average of hydropathy-0.003
Instability index45.50
Isoelectric point4.96
Molecular weight104234.79
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33951
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.25|      14|      27|     603|     616|       1
---------------------------------------------------------------------------
  603-  616 (25.18/16.53)	YLLIPTLLRQSMTA
  633-  646 (25.08/16.43)	YLLEPFLLPSLISA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.85|      25|      26|     665|     690|       2
---------------------------------------------------------------------------
  665-  690 (41.40/29.39)	LEVLIKPPGSVESR.DIHHTILAMCaP
  692-  717 (40.45/24.10)	LKMRLKAAGSQDTNaDPILQILNQC.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.95|      23|      27|     406|     429|       3
---------------------------------------------------------------------------
  406-  429 (33.09/27.01)	LLKGLNKGlYAKDDLVAQ..VNVNHI
  434-  458 (32.86/21.54)	LVEELTRS.DGSAGFISQavVEIMHI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     141.74|      42|      45|      43|      84|       5
---------------------------------------------------------------------------
   43-   84 (74.55/45.67)	FLECRDFFCQPGDPLISLYVDYIAITGIIAISDALIIL..TKRW
   89-  132 (67.19/40.50)	FPASRDTLACYNDTLQDLTMVVVSPKYKTTVSEARLALqiSSRW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     330.47|     108|     214|     270|     391|       6
---------------------------------------------------------------------------
  270-  391 (161.95/154.08)	LYLEGLLFTGSTIDDGGTVHWlSSRHQNDYQSMFSDiFTSSFSIL...KAQhttptrtLCVQQSQIFIQNK...LPALLSM.ISASSFNSFSTE.QAITEAWHQVMPLLSAqdllLTGARFLHvCALHHL
  487-  602 (168.51/120.22)	LFVRPSFFLGPLCGLLDEWRW.DEIHEGEAQPVYDD.FGAVFLLIlisRAR.......LALSNSSLGIRKKdgfLAQYLEQeNNEESLESLSEEkKSHLGNWINALYLAEG....LSDELFIN.CSPHDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.90|      17|      23|     874|     891|       8
---------------------------------------------------------------------------
  874-  891 (25.76/23.01)	DTTNPNLDAATAVsGGMD
  900-  916 (29.14/20.43)	DGIDQVLDEVAAM.GNLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.32|      13|      77|     850|     862|      10
---------------------------------------------------------------------------
  822-  836 (18.99/ 8.46)	YNDLGGLLKRGetLT
  850-  862 (25.32/13.57)	YTDLLGVPEMG..LD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33951 with Med5 domain of Kingdom Fungi
Unable to open file!