<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33950
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEPEHPQQIPEAAYPAPLPFWRHFTLANEQELRQLEESAPEGQTPQKLPLHLAYLRPPPPPPATAEFYTTFGQKQVIDPTKPSSLPTDQLLFDPDEPNLNHAVLLSKLTKSLLLNFLELTSILSLDPTKHEDKIADIRQLVLNIHVVINIYRPHQARESVKDMLIGILEDGQREIDECDRLKESLEEFLLDLGKADSQSGYVETQENAGTNNEVTHDQMMEKHRNLWKQIQDMT |
| Length | 235 |
| Position | Middle |
| Organism | Cladophialophora yegresii CBS 114405 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae>
Cladophialophora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.606 |
| Instability index | 54.73 |
| Isoelectric point | 4.85 |
| Molecular weight | 26865.06 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060
ECO:0000256 ARBA:ARBA00003669
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.09| 17| 47| 78| 94| 1
---------------------------------------------------------------------------
78- 94 (31.15/18.13) IDPTKPSSLPTD..QLLFD
126- 144 (24.94/13.23) LDPTKHEDKIADirQLVLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.96| 11| 27| 11| 21| 2
---------------------------------------------------------------------------
11- 21 (21.63/ 9.12) PEAAYPAPLPF
41- 51 (20.33/ 8.20) PEGQTPQKLPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.87| 19| 22| 150| 168| 3
---------------------------------------------------------------------------
150- 168 (32.41/23.26) NIYRPHQARESVKDMLIGI
175- 193 (30.46/21.46) EIDECDRLKESLEEFLLDL
---------------------------------------------------------------------------
|