<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33948
| Description |
Uncharacterized protein |
| Sequence | MSSDILTQLQTCYDQLLTQFFSTISYLSQRHALVAPEPDPNDPFTNPPSAAVVGAAASSQTPNPVDAAAAQLQASVNPGPEDTDRAPFPLRPVAPQTFANAQRELAEDLVLKGQQIEMLISRLPGIGRGEEQQAEDIRMLAEKVRKMEQERKVKRREMKEYVRRLESVVMGMAESVDYGADNGPNGHG |
| Length | 188 |
| Position | Middle |
| Organism | Cladophialophora psammophila CBS 110553 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae>
Cladophialophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.535 |
| Instability index | 53.25 |
| Isoelectric point | 4.92 |
| Molecular weight | 20617.96 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33948
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.04| 13| 15| 57| 70| 1
---------------------------------------------------------------------------
57- 70 (18.97/13.17) ASSqTPNPVDAAAA
74- 86 (23.07/11.55) ASV.NPGPEDTDRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.41| 11| 15| 138| 148| 2
---------------------------------------------------------------------------
138- 148 (18.95/12.58) RMLAEKVRKME
156- 166 (19.46/13.06) REMKEYVRRLE
---------------------------------------------------------------------------
|