<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33930
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASGKESDESADSPSSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQQPEYIKFIMYPHSLFFLELLQNANFRHAMAHPGNKELAHRQQFYYWKNYRNNRLKHILPRPLPEPPVAPPAPAPPQQPMPPVTAPTIAMPAAPAPVLSPMQYVNPQGSSLAKTDMRNSAVDRRKRKEILVQMGLRPLQIERMMTFR |
| Length | 218 |
| Position | Middle |
| Organism | Morus notabilis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.631 |
| Instability index | 73.56 |
| Isoelectric point | 9.34 |
| Molecular weight | 25374.93 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33930
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.04| 18| 18| 48| 65| 1
---------------------------------------------------------------------------
28- 41 (16.32/ 7.83) ....RQRFLLELEFVQCL
48- 65 (32.79/22.46) HYLAQNRYFEDEAFIGYL
69- 82 (23.94/14.60) QYWQQPEYIK...FIMY.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.22| 15| 16| 96| 111| 2
---------------------------------------------------------------------------
96- 111 (23.46/16.95) NFRHAMAHPGNKeLAH
114- 128 (29.76/16.93) QFYYWKNYRNNR.LKH
---------------------------------------------------------------------------
|