<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33916
Description |
Uncharacterized protein |
Sequence | MQLVEKLAEAIENGNRDQQSDALISDLNSHFEKCQQLLNSISGSLSTKAMGSDEQIPKLHRKAREVETVN |
Length | 70 |
Position | Middle |
Organism | Morus notabilis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
Aromaticity | 0.01 |
Grand average of hydropathy | -0.684 |
Instability index | 20.83 |
Isoelectric point | 5.21 |
Molecular weight | 7795.63 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33916
No repeats found
No repeats found
|