<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33912

Description ATP-dependent DNA helicase Q-like 4A
SequenceMQISCRSYVKPGKTIHVKNLNTENSPDVCKTTLQCSNDIDRGSGRNQTHQYFGSANASVSESTSHTSRYFPSSNAKCAEAGKSVGGQSQIRASMVYNSHHQVLAGSVSNYNVHTSQIKQSGTGLVSDMDDDEILENIDVDQIVEQYQSTCTPQPSMSKLPPITPSIDKSNFMGHESCLPPELCSICSHGFKLGTCPEAACHLQEMKDMLITISNELIDNFNDLSPAHMEKLRQNRLELNKQIQQLERYLRPNSVVEERQKSHFSTSTTPRSFQYEAPQAGSSWTEPSRFNAQVHLRNEPGLYESHNPSSISFSSIDREPYIPKFSEVSYIEGSNDKKWSSGNFSWTKKLEANNKKVFGNHSFRPNQREVINATMSGYDVFVLMPTGGGKSLTYQANIPAAYLSANMEWTEQQEIFRELASDYCKYKLLYVTPEKVAKSDVLVRHLGSLHSRELLARIVIDEAHCVSQWGHDFRPDYQGLGILKQKFPNTPVLALTATATASVKEDVVQALGLVNCIVFRQSFNRSNLYSVIPKTKKCLDDIDKFIKENHYDECGIIYCLSRMDCEKAAEKLQECGHKAAFYHGTMELSQRAFVQNQWSKDEINIICATVAFGMDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYSYSDFIRVKHMISQGVIEQSPFTSRKNGVNAMNSGGILETNTENLLRMVSYCENDVDCRRLLQLIHFGEKFDSAACKKTCDNCLKVKSFVDKDVTEMAKHLVELVKLTGGQHSSSHILEVYRGSLSQIVKKHKHEIIRLHGAGKHLAKGEASRILRYLVTEDILVEEVRKSDVYGSVSSVLKVNQSKAYDLCSGRRTIVLRLTLLPAFFLKLQNWFPSSVKVLKKSIVDITPAKGSLLHENLSPNISAQPQSEVDVNLSAKLFPALRKLRGALVKEAGEGVMAYHIFVDNTLKQMCKKLPRTKEELLEIHGIGKAKVMKYGDRILETIESVIKEHHRKDKNNSSSNESTDSIKKRRGGDPSPNLEDFEFNSTGRSKKMATKKQNKVDETSDCMEQDFCSQYIGNDLGFEKYDIETNGSVKTNQNGGRLLPLWSTLKNI
Length1088
PositionUnknown
OrganismMorus notabilis
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Moraceae> Morus.
Aromaticity0.07
Grand average of hydropathy-0.504
Instability index46.72
Isoelectric point8.46
Molecular weight122311.38
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IEA:InterPro
ATP binding	GO:0005524	IEA:UniProtKB-KW
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA recombination	GO:0006310	IEA:InterPro
DNA repair	GO:0006281	IEA:InterPro
DNA replication	GO:0006260	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33912
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.39|      15|      16|      47|      61|       1
---------------------------------------------------------------------------
   47-   61 (27.87/15.59)	QTHQYFGSANASVSE
   65-   79 (29.52/16.93)	HTSRYFPSSNAKCAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.62|      28|      59|     950|     977|       2
---------------------------------------------------------------------------
  950-  977 (47.52/30.35)	PRTKEELLEIHGIGKAKVM..KYGDRILET
 1010- 1039 (44.10/27.64)	PSPNLEDFEFNSTGRSKKMatKKQNKVDET
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.22|      16|      16|     310|     325|       3
---------------------------------------------------------------------------
  310-  325 (29.13/16.85)	ISF..SSIDREPYIPKFS
  327-  344 (25.09/13.50)	VSYieGSNDKKWSSGNFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.60|      15|      16|     157|     171|       4
---------------------------------------------------------------------------
  157-  171 (28.43/16.49)	SKLPPITPSIDKSNF
  176-  190 (32.17/19.62)	SCLPPELCSICSHGF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.70|      19|      60|     751|     789|       6
---------------------------------------------------------------------------
  751-  780 (16.95/47.27)	LVELVKltggqHSsshilEVYrGSLSQIVK
  814-  832 (32.75/12.14)	LVEEVR.....KS.....DVY.GSVSSVLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.55|      13|      15|     260|     273|       8
---------------------------------------------------------------------------
  260-  273 (18.82/15.21)	KSHfSTSTTPRSFQ
  278-  290 (24.74/14.47)	QAG.SSWTEPSRFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.33|      15|      15|     695|     709|       9
---------------------------------------------------------------------------
  695-  709 (28.06/19.07)	LLRMVSYCE..NDVDCR
  711-  727 (21.27/12.57)	LLQLIHFGEkfDSAACK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33912 with Med34 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VIKEHHRKDKNNSSSNESTDSIKKRRGGDPSPNLEDFEFNSTGRSKKMATKKQNKV
981
1036










Molecular Recognition Features






MoRF SequenceStartStop




NANANA