<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33903

Description Heat shock 70 kDa protein 4
SequenceMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPINTVFDAKRLIGRRFNDPSVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVKDEKIASKLDAADKKKIEDAIDAAIQWLDGNQLAESDEFEDKMKELESVCNPIIAKMYQGAGGDMGGAMDDDVPPSGGSGAGPKIEEVD
Length648
PositionUnknown
OrganismMorus notabilis
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Moraceae> Morus.
Aromaticity0.06
Grand average of hydropathy-0.406
Instability index33.53
Isoelectric point5.09
Molecular weight70996.65
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33903
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.24|      18|      41|     337|     356|       1
---------------------------------------------------------------------------
  337-  356 (25.55/21.56)	VHDVVLVGGSTRipKVQQLL
  381-  398 (29.70/17.55)	VQAAILSGEGNE..KVQDLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.62|      17|     187|     170|     188|       2
---------------------------------------------------------------------------
  170-  188 (22.05/22.00)	GLNVMRIINePTaAAIAYG
  362-  378 (31.58/19.97)	GKELCKSIN.PD.EAVAYG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      76.00|      18|      21|      38|      55|       3
---------------------------------------------------------------------------
   16-   33 (19.07/10.86)	....TTYSCVGVWQHDRveIIA
   38-   55 (32.65/23.59)	NR..TTPSYVAFTDTER..LIG
   60-   78 (24.28/15.75)	NQvaMNPINTVF.DAKR..LIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.70|      25|      45|     511|     535|       6
---------------------------------------------------------------------------
  511-  535 (40.37/24.41)	NDKGRLSKDEIEKMVQEAEKYKAED
  554-  578 (39.33/23.61)	NMRNTVKDEKIASKLDAADKKKIED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     109.02|      34|      44|     427|     461|       7
---------------------------------------------------------------------------
  427-  461 (52.33/43.86)	PTKKEQVFSTYSDNQPGVLiQVYEGERARTRDNNL
  474-  507 (56.69/42.37)	PRGVPQINVCFDIDANGIL.NVSAEDKTTGQKNKI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33903 with Med37 domain of Kingdom Viridiplantae
Unable to open file!