<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33902
Description |
Putative mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATPPVGAPGMEGRPPAPPPPPGTDMTGICFRDQLWLNSFPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDLTHLSKMTGTEYMLNEVLEPNLFVIRKQKRDGPEKVTPMLTYYVLDGSIYQAPQLCNVFAARAGRALYYLQKAFTNAASKLEKIGYVDSENENAPLDSKIGKETIDFKEMKRIDHILASLQRKLPPAPPPPPFPEGYVPPQNADSEKGPEAQQAGEAQQAPVDPIIDQGPAKRMRF |
Length | 251 |
Position | Head |
Organism | Morus notabilis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.522 |
Instability index | 56.94 |
Isoelectric point | 5.71 |
Molecular weight | 28115.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33902
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.93| 14| 29| 30| 43| 2
---------------------------------------------------------------------------
30- 43 (29.61/22.02) CFRDQLWLNSF.PLD
61- 75 (23.32/15.90) CNNEQLRMRSIhPLD
---------------------------------------------------------------------------
|