<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33896
Description |
Uncharacterized protein |
Sequence | MEAMKLIPETTENERDIEAMELYLPRLNLAYQKLTAKLQQLDSLPQQQKPEHYEKLKSLETKFERAMSCLQVPENSVSFCPGLVEKLAHFERQLKKLFSVNRRREPVSQLHQGQVPPSHMQTMQLPQSQITRVRFHENQMNPQLPSMHAQGSTETMQQNNSASLQETFISALSVEFQDLCLI |
Length | 182 |
Position | Tail |
Organism | Morus notabilis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.637 |
Instability index | 61.21 |
Isoelectric point | 6.31 |
Molecular weight | 21092.94 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33896
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.89| 21| 28| 100| 121| 2
---------------------------------------------------------------------------
100- 121 (34.61/22.50) VNRRREPVSQLHQgQVPPSHMQ
130- 150 (39.28/21.14) ITRVRFHENQMNP.QLPSMHAQ
---------------------------------------------------------------------------
|