<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33893

Description U-box domain-containing protein 51
SequenceMALSRSTSKLGDGSTVVAIDRDKNISLPLVKWAADNLFRVHKKSPCVILHVLNHSTHSHSHSTVSKGSNRSTEEELQEIILPCLGYCARKGITAKEVLLHDIDVPSAIIDYIIKNDISNVVVGASNRNAILRKFKAADVPTSLIKSAPNFCSVYVISKGKPQTVRAATQALKPKNDVPPSYRSAPNLGSAESGSSSKLSATNVSSFMSMPSTNHSRSSSTSNSSSPPTSSSLQGNPQSDFSGFSGLNSFQSATYNTLDSFTSLEISGNTFIVQTPEDLEAEMSTLNVQLKQTMDIYNSVCNEATEAKERVNELHLKPAKERSLEEATAAEEAATAFAELEKQKTKLATEAAHIAERIAEIETQKRKFAEMRAGGQEAEQIGAVRGGVKYRRYTIQEIQSATDYFNNKQKIGEGGYGPVYKGFLDHTPVAIKILRPDISQGLVQFQQEVEVLSCIRHPNMVLLVGACPEYGCLVYEYMDNGSLEDRLFCKDNTSPLSWRTRFKIAAEIATSLLFLHERKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPASAANSVTQYHMTAAAGTFCYIDPEYQQTGLLGVKSDVYSLGVMLLQIITSKPPIGLSYQVEEAIEQGTFAEILDPTVLDWPVEEALCFAKLALQCCEMRKRDRPDLGSVVLPELNRLTNLGMVEDYGK
Length681
PositionTail
OrganismMorus notabilis
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Moraceae> Morus.
Aromaticity0.06
Grand average of hydropathy-0.262
Instability index43.29
Isoelectric point6.25
Molecular weight74650.90
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33893
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.07|      32|      34|     189|     222|       1
---------------------------------------------------------------------------
  182-  213 (52.11/31.67)	RSAPNLGSAESGSSSKLSATNVSSFMSMPSTN
  216-  247 (55.96/42.79)	RSSSTSNSSSPPTSSSLQGNPQSDFSGFSGLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      84.68|      20|      20|     326|     345|       2
---------------------------------------------------------------------------
  303-  319 (21.03/14.87)	...ATEAKERVNELHLKPAK
  326-  345 (31.49/26.43)	ATAAEEAATAFAELEKQKTK
  347-  366 (32.16/27.17)	ATEAAHIAERIAEIETQKRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     114.57|      33|      35|     108|     142|       3
---------------------------------------------------------------------------
   85-  111 (26.83/17.19)	.........GYCARKGITAKevlLHDI.....DVPSAIIDY
  114-  146 (51.66/46.01)	KNDISNVVVGASNRNAILRK...FKAA.....DVPTSLIKS
  147-  180 (36.08/22.42)	APNFCSVYVISKGKPQTVRA...ATQAlkpknDVPPS....
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33893 with Med32 domain of Kingdom Viridiplantae
Unable to open file!