<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33892
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPFYRLYKDYLQDPKSAPAPPPPIEGTYVCFGANYTTDDVLPSMEEQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQRFLPSLSSVVTPQARATLIHILELQIQSRKQAVEDIKRRREEAQRLLKESLGTLELS |
| Length | 181 |
| Position | Middle |
| Organism | Morus notabilis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.503 |
| Instability index | 75.10 |
| Isoelectric point | 8.65 |
| Molecular weight | 20822.68 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33892
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.65| 10| 19| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (24.43/10.82) P.PPPPFYRLY
27- 37 (19.23/ 7.32) PaPPPPIEGTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.25| 23| 58| 66| 88| 2
---------------------------------------------------------------------------
66- 88 (39.65/28.12) PNVDFKKELRSL....NRELQLHILEL
122- 148 (34.60/23.69) PHQRFLPSLSSVvtpqARATLIHILEL
---------------------------------------------------------------------------
|