<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33885
| Description |
Uncharacterized protein |
| Sequence | MDPEIKKFGRGPRELTGAVDLISHYKLLAHHDFFCKRSLPLAIADTHYLHNVVGDTEIRKGEGMQLDQLIQNTSYSRDTNARIQPFDLDILQEAFQLRETGPIDLPPAEKGILTIAGKSKSEFKDKERKHKKHKDRDKEKDKEHKKHKHHHKDRSKDKDKDKKKDKSGHHDSGADHTKKHHEKKRKHEGDEDINDVHRHKKSKHKSSKIDEMGAIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Morus notabilis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.400 |
| Instability index | 31.82 |
| Isoelectric point | 9.45 |
| Molecular weight | 25344.31 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33885
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.49| 17| 21| 133| 153| 1
---------------------------------------------------------------------------
133- 153 (27.84/14.14) HKDRDKEKdkehKKHKHHHKD
155- 171 (29.65/ 8.10) SKDKDKDK....KKDKSGHHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.90| 12| 20| 180| 191| 2
---------------------------------------------------------------------------
180- 191 (23.83/10.94) HHEKKRKHEG...DE
197- 211 (18.08/ 6.54) HRHKKSKHKSskiDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.33| 15| 20| 71| 90| 3
---------------------------------------------------------------------------
70- 88 (22.51/27.42) I.QNTSYSRDTNariqPFDL
90- 105 (21.83/ 9.69) IlQEAFQLRETG....PIDL
---------------------------------------------------------------------------
|