<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33881
| Description |
Uncharacterized protein |
| Sequence | MAERQGLDQQHQTDPPLQSAGAPKEDMIACLMALEASLLPCLPAKELQAIDRSPHPSHQIDVERHARDFMEAAKKLQLYFIGLQREEQPNKAETLRKEIAAMEEELKHKTEIINKHEKLILGWRKELKDQLDKHQTELERHCLNPSMANQLVRLANFTLLAVIVCCFCAMIASALQKSSIKCGFSKEGGTVLYF |
| Length | 194 |
| Position | Head |
| Organism | Morus notabilis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.374 |
| Instability index | 56.56 |
| Isoelectric point | 6.45 |
| Molecular weight | 22000.32 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33881
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 60.67| 15| 23| 102| 116| 1
---------------------------------------------------------------------------
86- 98 (15.32/ 6.60) ..EEQ.PNKAETLRKE
102- 116 (26.46/15.77) MEEEL.KHKTEIINKH
127- 141 (18.89/ 9.54) LKDQLdKHQTE.LERH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.20| 18| 140| 27| 46| 2
---------------------------------------------------------------------------
27- 46 (28.79/24.39) MIAClmALEASLLPCLPAKE
170- 187 (32.40/20.34) MIAS..ALQKSSIKCGFSKE
---------------------------------------------------------------------------
|