<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33879
| Description |
Uncharacterized protein |
| Sequence | MEEKAVNSMAIASLKTTQDLAMEGQKHLEDTIESAFQILSSMNDELCNPALWSTTTTVAAATSSSSPSSAANGPSSHSNGLVNGDAAASDSHHHADLGGGGGAAGGALGEAQFRYKNAVASLRAILAAIPNSQRGRTFETGTTPTSSVTPAQEVEIEKLEERASNLRTELANKNAYLKILIDQLRDLITDISTWQSPCSV |
| Length | 200 |
| Position | Head |
| Organism | Morus notabilis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Moraceae> Morus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.303 |
| Instability index | 44.36 |
| Isoelectric point | 4.95 |
| Molecular weight | 20915.85 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33879
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.87| 14| 14| 75| 88| 1
---------------------------------------------------------------------------
75- 88 (24.95/14.13) SSHSNGLVNGDAAA
91- 104 (26.92/15.73) SHHHADLGGGGGAA
---------------------------------------------------------------------------
|