<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33877
Description |
Meiotic mRNA stability protein kinase SSN3 |
Sequence | MYPTRRPPPFYPPSTAERNSLGYQSKVRVVDQYKVIGFISSGTYGRVYKAVGRDGRPGEFAIKKFKPDKEGEQIQYTGISQSAVREMALCSELSHMNVIRLVEIILEDKCIFMVFEYAEHDLLQIIHHHTQPTRHPIPPPTVKSIIFQLLNGCQYLHANWVLHRDLKPANIMVSSSGEVKIGDLGLARLFNKPLHSLFSGDKVVVTIWYRAPELLLGSKHYTPAIDMWAIGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPHLVHMPEYSQLSTLSANGHAKAGYSSLEKWYYQTINASSTSVPVSNLNLGAEGYKLLSSLLEYDPEKRLTAQAALTHPFFSTGDKVSANVFEGVKTEYPHRRVSQDDNDIRTGSLPGTKRSGLPDDSRPAKRLKE |
Length | 415 |
Position | Kinase |
Organism | Sclerotinia borealis (strain F-4128) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Sclerotinia.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.376 |
Instability index | 39.16 |
Isoelectric point | 9.21 |
Molecular weight | 46840.26 |
Publications | PubMed=24459262
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33877
No repeats found
|