<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33876
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MASQDPPLDEIQWRDPQWLAANGGIHENTILHYFAQSPFFDRTSNNSIVTTQATFNNNLWYLLGTRGAFEGRLKTMSGLEFIIAQEPAAMGPGTGTGVWVIRKQTRRKRAPEDDEIIIHSSYFVVGENIYMAPTVADVLGSRMLSIFTSLTNAISKVSELPNFSPSLGHTYMPPVPPRTKAVTSTFSQTEENTPMPDSLATEAKNPSVSTSTNVLAHHLLEETLNITLKYGDEYMDENPITGTPGDFHFSTTGRKEKERLMVPPTSKPAGFGLSGKPAAPTPLKTDLGIQKKGSKGEKSPRTPGTGKPKRRKSKVMNGGVSPT |
Length | 323 |
Position | Head |
Organism | Sclerotinia borealis (strain F-4128) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Sclerotinia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.512 |
Instability index | 47.56 |
Isoelectric point | 9.10 |
Molecular weight | 35276.53 |
Publications | PubMed=24459262
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33876
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.45| 16| 21| 237| 254| 2
---------------------------------------------------------------------------
237- 254 (27.74/17.21) EN.....PITGTPGDFHFSttGR
256- 276 (24.70/ 9.91) EKerlmvPPTSKPAGFGLS..GK
---------------------------------------------------------------------------
|