Description | Mediator-RNA polymerase II transcription subunit 21 |
Sequence | MGDRLTQLQDAVDQLATQFVACLHYVNKRHDLETLGPNDKVREVKDAPKEVDSLPPDEFRAGMVELSQDLIVKEQQIEVLISSLPGLDNSEMDQEKYIKELEEDLKIAEAQRQEAIKEKDQILSELDSVIRSIRRP |
Length | 136 |
Position | Middle |
Organism | Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium fujikuroi species complex. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.634 |
Instability index | 57.37 |
Isoelectric point | 4.58 |
Molecular weight | 15569.40 |
Publications | PubMed=20237561 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP33848 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 39.44| 12| 33| 65| 76| 1 --------------------------------------------------------------------------- 65- 76 (20.05/11.67) ELSQDLIVKEQQ 100- 111 (19.39/11.10) ELEEDLKIAEAQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.19| 21| 37| 3| 23| 2 --------------------------------------------------------------------------- 3- 23 (36.22/23.91) DRLTQLQDA...VDQL.ATQFVACL 39- 63 (26.98/16.31) DKVREVKDApkeVDSLpPDEFRAGM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KVREVKDAPK 2) SLPPDEFRAGMVELSQDLIVKEQQIEVLISSLPGLDNSEMDQEKYIKELEEDLKIAEAQRQEAIKEKDQILS | 40 53 | 49 124 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab